Document	Document Title
US09898341B2	Adjustable priority ratios for multiple task queues In some examples, a method includes assigning, to each respective task queue of a plurality of task queues, a respective priority ratio based at least in part on a number of tasks in the respective task queue. The method further includes assigning, by a processor of a plurality of processors, respective tasks from the respective task queues to at least one processor of the plurality of processors in an order based at least in part on the respective priority ratio, wherein the respective priority ratio defines a relative frequency with which tasks from the respective task queue are assigned to the at leak one processor.
US09898336B2	Resource allocation for software development Software development data indicative of a development activity is accessed. A component parameter of a component of a software development platform is set, in which the component parameter is based upon, at least in part, an anticipated component workload associated with the development actively. At least one system resource is allocated for the component of the software development platform based upon, at least in part, the component parameter.
US09898332B2	Generating differences for tuple attributes A sequence of tuples, each having one or more attributes, is received at one of one or more processing elements operating on one or more processors. Each processing element may have one or more stream operators. A first stream operator may be identified as one that only processes an instance of a first attribute in a currently received tuple when a difference between an instance of the first attribute in a previously received tuple and the instance of the first attribute in the currently received tuple is outside of a difference threshold. A second stream operator may generate a difference attribute from a first instance of the first attribute in a first one of the received tuples and a second instance of the first attribute in a second one of the received tuples. The difference attribute may be transmitted from the second stream operator to the first stream operator.
US09898324B2	Maintaining virtual machines for cloud-based operators in a streaming application in a ready state A streams manager monitors performance of a streaming application, and when the performance needs to be improved, the streams manager automatically requests virtual machines from a cloud manager. The cloud manager provisions one or more virtual machines in a cloud with the specified streams infrastructure and streams application components. The streams manager then modifies the flow graph so one or more portions of the streaming application are hosted by the virtual machines in the cloud. When performance of the streaming application indicates a virtual machine is no longer needed, the virtual machine is maintained and placed in a ready state so it can be quickly used as needed in the future without the overhead of deploying a new virtual machine.
US09898323B2	Composite virtual machine template for virtualized computing environment Composite virtual machine templates may be used in the deployment of virtual machines into virtualized computing environments. A composite virtual machine template may define a plurality of deployment attributes for use in a virtual machine deployment, and at least some of these deployment attributes may be determined through references to other virtual machine templates and included in the composite virtual machine template.
US09898317B2	Physical path determination for virtual network packet flows In general, techniques are described for configuring and managing virtual networks. For example, a distributed virtual network controller is described that configures and manages an overlay network within a physical network formed by plurality of switches. A plurality of servers are interconnected by the switch fabric, each of the servers comprising an operating environment executing one or more virtual machines in communication via the overlay networks. The servers comprises a set of virtual switches that extends the overlay network as a virtual network to the operating environment of the virtual machines. The controller may instruct the servers and the virtual switches to perform various operations, such as determining a physical network path taken by packets of a network packet flow, determining latency through the network, re-routing traffic in the virtual network due to network events, replicating traffic for multicasting, providing multi-tenant services to support multiple virtual networks, monitoring and logging traffic characteristics within the virtual networks and other operations.
US09898316B1	Extended fractional symmetric multi-processing capabilities to guest operating systems Operating at least one hypervisor includes running a first hypervisor as a first thread of an underlying operating system, running a second hypervisor as a second thread of the underlying operating system, loading a first guest operating system using the first hypervisor based on the first thread of the underlying operating system, loading a second guest operating system using the second hypervisor based on the second thread of the underlying operating system, and scheduling sharing of resources of the underlying system between the first hypervisor and the second hypervisor according to a scheduler of the underlying operating system, where the first hypervisor and the second hypervisor run independently of each other. The scheduler of the underlying operating system may schedule fractional time shares for the first hypervisor and the second hypervisor to access the same resource.
US09898314B2	Javascript extension tool A method, system, and apparatus for extending JavaScript to operate more fully as an object oriented language. A multiple inheritance module may be configured to enable JavaScript to implement multiple inheritance. A messaging module may be configured to enable JavaScript to implement messaging. A polymorphism module may be configured to enable JavaScript to implement polymorphism.
US09898303B2	Multi-core hardware semaphore in non-architectural address space A microprocessor includes a plurality of processing cores, a resource shared by the plurality of processing cores, and a hardware semaphore readable and writeable by each of the plurality of processing cores within a non-architectural address space. Each of the plurality of processing cores is configured to write to the hardware semaphore to request ownership of the shared resource and to read from the hardware semaphore to determine whether or not the ownership was obtained. Each of the plurality of processing cores is configured to write to the hardware semaphore to relinquish ownership of the shared resource.
US09898295B2	Branch prediction using multiple versions of history data Branch prediction is provided by generating a first index from a previous instruction address and from a first branch history vector having a first length. A second index is generated from the previous instruction address and from a second branch history vector that is longer than the first vector. Using the first index, a first branch prediction is retrieved from a first branch prediction table. Using the second index, a second branch prediction is retrieved from a second branch prediction table. Based upon additional branch history data, the first branch history vector and the second branch history vector are updated. A first hash value is generated from a current instruction address and the updated first branch history vector. A second hash value is generated from the current instruction address and the updated second branch history vector. One of the branch predictions are selected based upon the hash values.
US09898293B2	Decoding instructions that are modified by one or more other instructions Methods and apparatus are provided for decoding instructions in a computer program wherein the instructions include one or more base instructions that are subject to modification by one or more other instructions. A decoder determines whether a first received instruction was arrived at by a non-incremental change to a program counter (i.e. a jump in the program). If the first instruction was arrived at by a non-incremental change to the program counter the decoder decodes the immediately preceding instruction to determine if the original instruction is a base instruction subject to modification by one or more other instructions. If the preceding instruction indicates that the original instruction is a base instruction an error has occurred and exception handling code is invoked.
US09898281B2	Verifying source code in disparate source control systems A computer program product for verifying source code in disparate source control systems. A processor configured to: obtain a first source code from a target repository; access a second source code from a source repository; and verify each file in the first source code matches each corresponding file in the second source code. Verifying causes the processor to: read contents of a file in the first source code in the target repository; access a corresponding file in the second source code in the source repository; replace contents of the corresponding file in the second source code in the source repository with the contents of the file in the first source code in the target repository; execute an editor in the source repository to display differences in the corresponding file that have been modified as a result of replacing contents; and log each file that does not match.
US09898269B2	Build deployment automation for information technology mangement A computer-executable mechanism captures code modifications for a computer-executable process from a development environment into build packages that may be deployed onto specified target environments with trace, audit, code compliance and rollback options from one single web portal. The mechanism supports build package code changes from different sources, automated test of the resulting build packages, and phantom source control of all packaged code base to reduce the burden on developers to manually source control code. The computer-executable mechanism supports a portal web server for building and deploying build packages to render user responses to configurable actions that may be passed on to a job sequencer to execute a series of jobs. A computer-executable roll-back mechanism takes a snapshot of the target environment prior to deployment of a build package so that a complete release rollback or an incremental release rollback may occur as needed.
US09898267B2	Correlation analysis of program structures System and method for performing correlation analysis. A program that includes multiple program structures and one or more data objects is stored. Each data object is shared by at least two of the program structures. For each program structure, decomposition effects on each of the data objects shared by the program structure resulting from each of a respective one or more optimizing transforms applied to the program structure are analyzed. One or more groups of correlated structures are determined based on the analyzing. Each group includes two or more program structures that share at least one data object, and at least one optimizing transform that is compatible with respect to the two or more program structures and the shared data object. For at least one group, the at least one optimizing transform is usable to transform the two or more program structures to meet a specified optimization objective.
US09898261B1	Method and system for configuring processes of software applications using activity fragments A method for creating processes in a software application. The method includes obtaining an activity fragment. The activity fragment includes an activity fragment name and an activity fragment configuration. The method further includes obtaining a process specification specifying an activity, and obtaining activity configuration instructions. The activity configuration instructions specify inclusion of the activity fragment in the activity. The method also includes building, based on the process specification, a process. Building the process includes associating the activity fragment with the activity. In addition, the method includes deploying the software application, including the process.
US09898260B2	Adaptive function-based dynamic application extension framework A mobile device includes a processor and a non-transitory computer-readable medium storing instructions. The instructions include, in response to a state of a first application being instantiated from a first state template of the first application, selecting a first function module identifier from a plurality of predetermined function module identifiers. Each predetermined function module identifier corresponds to a first function offered by the first state template. The instructions include transmitting a function module request to a developer exchange system using a wireless transceiver. The function module request includes the first function module identifier, which uniquely identifies a first function module. The instructions include receiving the first function module from the developer exchange system, storing and executing the first function module, and presenting display data generated by execution of the first function module. The display data is presented in an area reserved for the first function by the first state template.
US09898259B2	Data binding for model-based code generation The disclosure generally describes methods, software, and systems, including a method for using templates to generate data bindings for application code. A request is identified to instantiate an application based on a pre-defined template that is associated with an input data model that includes at least one reference to a design time data binding configuration model. A service, an associated service, and an associated data source are identified to be bound with the application. A parameter in the input data model is identified. Entry point data bindings for the data source are identified. A selection field is populated within a user interface using values within the data source corresponding to the entry points. A second selection field within the user interface is populated based on the selection from the first selection field. The second selection field is associated with at least one parameter in the input data model.
US09898249B2	System and methods for simulating real-time multisensory output The invention is directed to a system and methods allowing a user to interact with one or more data applications—including for example, games, music, music composition and tactile stimulation—to simulate real-time multisensory output. The invention includes a music program, a music texture program and a simulation program.
US09898243B2	Information processing apparatus, program, information processing system, and information processing method An information processing apparatus for displaying a specified display area of target data in a display unit, the target data being shared with another information processing apparatus. The information processing apparatus includes: a reception unit that receives information indicative of the specified display area specified in the another information processing apparatus; and a display controlling unit that scales the specified display area and an image in a peripheral portion of the specified display area and displays the specified display area and the image in the display unit such that the specified display area is included in a display field of the display unit based on the received information indicative of the specified display area and information about the display field of the display unit.
US09898241B2	Information sharing system, image processing apparatus, and image processing method An information sharing system includes a first image processing apparatus and a second image processing apparatus connected thereto via a communication network. The first apparatus includes an input unit to input image data, a dividing unit to divide the data into divided image data items, a storage unit to store the divided image data items at respective destinations and output position data items indicating the destinations, a generation unit to generate notification data items each including a corresponding divided image data item and a corresponding position data item, and a transmission unit to sequentially transmit the notification data items to the second apparatus. The second apparatus includes a reception unit to receive the notification data items from the first apparatus and a reproduction unit to reproduce the image data by developing the divided image data items in order of receipt based on the data in the notification data items.
US09898217B2	Two stage memory allocation using a cache The presently claimed invention manages memory in a multi-processor system. The presently claimed invention may use a combination of global and local locks when allocating memory and de-allocating memory in a multi-processor system. A method consistent with the presently claimed invention may first receive an allocation of a first memory space in the system memory of a multi-core processing system. The allocation of the first memory space may globally locks the first memory space where the memory space may administered by a software module using one or more local locks.
US09898215B2	Efficient management of page retirement in non-volatile memory utilizing page retirement classes In at least one embodiment, a non-volatile memory array including a plurality of blocks each including a plurality of physical pages is controlled by a controller. The controller implements a plurality of nested page retirement classes each defined by a respective one of a plurality of different nested subsets of page indices of physical pages within the plurality of blocks that are to be considered retired from use. For each block among the plurality of blocks, the controller updating an indication of a page retirement class to which the block belongs in response to detection of a retirement-causing error in a data page stored in a physical page of the block. The controller forms block stripes for storing data from the plurality of blocks based on the page retirement classes of the blocks.
US09898211B2	Nonvolatile memory control device, nonvolatile memory control method and computer readable storage medium A nonvolatile memory control device performs data reading/writing control on partitions of a rewritable nonvolatile semiconductor memory. The device includes an erase cycle counting unit, a read cycle counting unit, a data reading/writing unit and a control unit. The erase cycle counting unit counts the number of erase cycles in total per partition. The read cycle counting unit counts the number of read cycles that same data is read per partition. When the number of erase cycles of a first partition is equal to or larger than a predetermined number of erase cycles, and a second partition having a smaller number of erase cycles and a larger number of read cycles than the first partition is present, the control unit controls the data reading/writing unit to exchange data in the first partition and data in the second partition.
US09898207B2	Storage device A storage device is provided. The storage device includes storage clusters, and a controller. The controller receives a command and an address from an external host device, selects a storage cluster according to the received address, and transmits the received command and the received address to the selected storage cluster. The controller controls the storage clusters as normal storage clusters and slow storage clusters according to a temperature of a zone to which the storage clusters belong.
US09898196B1	Small block write operations in non-volatile memory systems A first portion of an asymmetric memory is configured as temporary storage for application data units with sizes corresponding to a small memory block that is smaller than the size of a logical write unit associated with the asymmetric memory. A portion of the remaining asymmetric memory is configured as a reconciled storage for application data units with varying sizes. A first application data unit is received for writing to the asymmetric memory. Based on computing the size of the first application data unit as corresponding to the small memory block, the first application data unit is written to the temporary storage. Upon determining that a threshold is reached, a memory write operation is performed for writing the application data units from the temporary storage to the reconciled storage. The application data units written to the reconciled storage are removed from the temporary storage.
US09898193B2	Application-specific integrated circuit and measurement transmitter having such a circuit An application-specific integrated circuit comprises: analog inputs having analog-digital converters; at least one digital signal processor, which has input registers and output registers. The analog-digital converters sample and digitize input signals Si with sampling frequencies fSi and forward the digitized signals SDi with output frequencies fSD-out-i to the input registers of the digital signal processor. The digital signal processor processes the digitized signals SDi to m processed signals SPj and forwards such to the output registers of the digital signal processor. The digital signal processor has a clock frequency, wherein, furthermore, the signals of the output registers can be output, respectively read-out, with an output frequency. One or more of the frequencies is, respectively, variable, wherein especially one or more of the frequencies, respectively, variable independently of the others of the frequencies.
US09898190B2	Multi-touch object inertia simulation The inertia system provides a common platform and application-programming interface (API) for applications to extend the input received from various multi-touch hardware devices to simulate real-world behavior of application objects. To move naturally, application objects should exhibit physical characteristics such as elasticity and deceleration. When a user lifts all contacts from an object, the inertia system provides additional manipulation events to the application so that the application can handle the events as if the user was still moving the object with touch. The inertia system generates the events based on a simulation of the behavior of the objects. If the user moves an object into another object, the inertia system simulates the boundary characteristics of the objects. Thus, the inertia system provides more realistic movement for application objects manipulated using multi-touch hardware and the API provides a consistent feel to manipulations across applications.
US09898187B2	Managing real-time handwriting recognition Methods, systems, and computer-readable media related to a technique for providing handwriting input functionality on a user device. A handwriting recognition module is trained to have a repertoire comprising multiple non-overlapping scripts and capable of recognizing tens of thousands of characters using a single handwriting recognition model. The handwriting input module provides real-time, stroke-order and stroke-direction independent handwriting recognition for multi-character handwriting input. In particular, real-time, stroke-order and stroke-direction independent handwriting recognition is provided for multi-character, or sentence level Chinese handwriting recognition. User interfaces for providing the handwriting input functionality are also disclosed.
US09898184B2	Operation method of operating system An operation method of an operating system, applied to an electronic device. The electronic device includes a touchpad and a screen. The touchpad has a first edge. The electronic device is used for executing the operating system. The screen is used for displaying a display image outputted by the operating system. A cursor is displayed at the display image. The operation method of the operating system comprises: determining whether a touch operation is a sliding gesture sliding from an edge when the touchpad senses the touch operation; determining which edge of the touchpad is sliding from by the sliding gesture if the touch operation is the sliding gesture sliding from the edge; displaying a charm bar in a first area of the display image and displaying the cursor on the charm bar if the sliding gesture slides from the first edge.
US09898169B2	Screen help with contextual shortcut on an appliance On-screen help with contextual shortcut on an appliance The invention relates to an appliance (100) with a user interface (110) comprising a display (111) for showing indications about conditions in the appliance, and first (112, 114) and second (113) touch-sensitive input means. The second input means causes the interface to enter an assistance mode displaying which assistance items, which a processing means (121) extracts from a collection (122) of assistance information based on the content of the display when the assistance mode is invoked. In one embodiment, a data record ensures that the user returns to the same page after consulting the assistance mode. In another embodiment, the appliance is adapted to update the collection of assistance information on the basis of data received at an external communication interface. In another embodiment, the display reacts differently to short and long activations of a given touch-sensitive input means. In another embodiment, the display includes parallax compensation.
US09898165B1	Taxi route recording methods on an aircraft display unit Present novel and non-trivial methods for electronically recording a taxi route on a display unit are disclosed. In one method, a tax route entry window (“TREW”) such as a taxi clearance entry window is used to present in smaller windows surfaces and next intersecting surfaces from which a pilot sequentially selects surfaces based upon surfaces stated in a taxi clearance. In another method, the TREW is comprised of an airport-specific keyboard or a traditional keyboard with visually-variable, interactive buttons, where an activation or deactivation of each button is dependent upon surfaces specified in the taxi clearance and potential intersecting surface. In another method, selections are made on the TREW and surfaces corresponding to the selections are highlighted in an image presenting a map of surfaces. Additionally, the image presenting a map of surfaces may be panned and zoom to the size of the highlighted surface.
US09898163B2	Menu display apparatus, menu display method and program Provided is a menu display apparatus that displays a menu of a plurality of applications, including an acquisition unit that acquires display data of content information representing content to be displayed in the menu of the content managed by each application from each application and a display controller that controls a display of the content information in each area according to setting conditions for the area provided for each of the applications in the menu and the display information of the content information acquired from each application. Accordingly, the display of the content information to be displayed in the menu in each area is controlled according to setting conditions for the area provided for each application in the menu and display data of the content information acquired from each application.
US09898156B2	Method and computing device for window width and window level adjustment utilizing a multitouch user interface A method, computing device and computer program product are provided in order to utilize a multitouch user interface so as to adjust the window width and window level of an image. In the context of a method, an indication of user input provided via a multitouch user interface is received. The indication of user input includes an indication of respective positions of first and second fingers upon the multitouch user interface. The method also includes adjusting, with processing circuitry, a window width of an image based upon a change in spacing between the first and second fingers. Further, the method includes adjusting, with the processing circuitry, a window level of the image based upon a change in location of a reference point defined by the respective positions of the first and second fingers upon the multitouch user interface.
US09898146B2	Touch panel and display device including the same A display device includes: a plurality of first electrode patterns; a plurality of second electrode patterns; a plurality of first touch signal lines; and a plurality of second touch signal lines. The plurality of first electrode patterns respectively include a plurality of first electrode cells physically separated from each other and arranged in a first direction. The plurality of second electrode patterns include a plurality of second electrode cells physically separated from each other and arranged in a second direction crossing the first direction. The plurality of first touch signal lines are connected to the first electrode cells. The plurality of second touch signal lines are connected to the second electrode cells. The first and second electrode patterns and the first and second touch signal lines are all positioned at the same layer on a substrate. The first touch signal lines are independently connected to each first electrode cell.
US09898145B2	Touch display panel and touch display device with the touch display panel The present disclosure provides a touch display panel and a touch display device. The touch display panel includes a first substrate and a second substrate arranged opposite to each other to form a cell. The second substrate includes a matrix common electrode. The touch display panel further includes a first signal transmission line arranged on the first substrate and a second signal transmission line arranged on the first substrate, and the second signal transmission line is intersected with the first signal transmission line; and a first spacer corresponding to the first signal transmission line and a second spacer corresponding to the second signal transmission line. The first spacer and the second spacer are configured to enable the first signal transmission line and the second signal transmission line to be electrically connected to the matrix common electrode when a corresponding touch region is in a touch state.
US09898142B2	Touch detection on a curved surface A system includes a curved window and a light energy emitter arranged exterior to the curved window. The system includes a light energy receiver arranged exterior to the curved window and arranged to detect light energy emitted by the light energy emitter. The light energy passes over a touchpad provided on the curved window. A touch on the touchpad may be detected by the system.
US09898141B2	Touch panel, method for fabricating the same and touch display device A touch panel, a method for fabricating the same and a touch display device are disclosed. The touch panel includes touch units, each of which includes: a capacitor having a first terminal connected to a first bias voltage; a first transistor having an amorphous silicon active layer, one of a source and a drain of the first transistor is connected to a third bias voltage and the other is connected to a second terminal of the capacitor; a second transistor having an oxide semiconductor active layer, a gate of the second transistor is connected to a scan line, one of a source and a drain of the second transistor is connected to the second terminal of the capacitor and the other is connected to a data line. The touch panel further includes a light-shielding layer; an aperture portion is disposed on a part of the light-shielding layer.
US09898136B2	Method for specifying touched position determined by first coordinate along first signal line and second coordinate along second signal line, and circuit for specifying the touched position A capacitance distribution detection circuit includes a multiplexer, a driver, and a sense amplifier, and the multiplexer switches states between a first connection state in which first signal lines are connected to the driver and second signal lines are connected to the sense amplifier, and a second connection state in which the first signal lines are connected to the sense amplifier and the second signal lines are connected to the driver.
US09898130B2	Grip management Grip management includes determining, using first changes of capacitance of a sensing region of an input device, a first signal level corresponding to a first input object satisfying a size threshold and being proximate to a first side of the input device at a first time, and determining a first signal level threshold based on the first signal level. The grip management further includes determining, using second changes of capacitance of the sensing region, a second signal level corresponding to the first input object being proximate to the first side of the input device at a second time, and detecting a squeeze of the input device based at least in part on the second signal level satisfying the first signal level threshold.
US09898127B2	Pixel structure, display apparatus comprising the same driving method and manufacturing method for the pixel structure A pixel structure includes a pixel electrode and a pixel switch including a gate electrode, an upper source electrode, an upper drain electrode, an upper active layer, a lower source electrode, a lower drain electrode, and a lower active layer. A bottom-gate TFT is formed by the upper source electrode, the upper active layer, the upper drain electrode and the gate electrode; a top-gate TFT is formed by the lower source electrode, the lower active layer, the lower drain electrode and the gate electrode. The upper source electrode is connected to the lower source electrode. The pixel electrode includes a first sub-pixel electrode and a second sub-pixel electrode. The first sub-pixel electrode is connected to the upper drain electrode for receiving a first signal; the second sub-pixel electrode is connected to the lower drain electrode for receiving a second signal from the bottom-gate TFT different from the first signal.
US09898123B2	Sensing device A sensing device includes a comparator, a first and a second variable capacitor unit. A first comparator input of the comparator is electrically coupled to a touch pad. The first variable capacitor unit is configured to charge the first comparator input such that the first comparator input has a first potential. The second variable capacitor unit is configured to charge a second comparator input of the comparator such that the second comparator input has a second potential. The comparator is configured for comparing the first potential and the second potential to generate a comparator output signal. In a condition of the touch pad being operated, the first variable capacitor unit is adjusted according to the comparator output signal to perform potential compensation for the first comparator input, or the second variable capacitor unit is adjusted according to the comparator output signal to perform potential compensation for the second comparator input.
US09898114B2	Electroactive privacy layer of a display device Techniques related to privacy at display devices are described herein. The techniques include an apparatus having an electroactive privacy layer of a display device. The electroactive privacy layer is configured to restrict a propagation direction of light emission associated with a display layer of the display device. The restriction of propagation is generated by an electric force applied to the electroactive privacy layer.
US09898112B2	Display module and electronic terminal The present invention provides a display module (100; 200) and an electronic terminal. The display module (100; 200) comprises: a first display unit (130; 240) configured to display first image information in a first direction; a second display unit (140; 250) configured to display second image information in a second direction; and a sensor unit (150; 260) provided between the first display unit (130; 240) and the second display unit (140; 250) and configured to sense an object's approach or touch on the first display unit (130; 240) and/or the second display unit (140; 250). With the display module (100; 200), the object's approach or touch on the first display unit (130; 240) and the second display unit (140; 250) can be sensed by a single sensor unit (150; 260). There is no need to provide a sensor unit (150; 260) for each of the display units (130; 240; 140; 250) for touch sensing function. In this way, it is possible to reduce the thickness of the display module (100; 200), make it slimmer and more beautiful while reducing manufacture cost.
US09898108B2	Image erasing device for electronic chalkboard system, control method thereof, display apparatus, control method thereof, and electronic chalkboard system An erasing device to erase an image displayed on a display apparatus, the erasing device including: a housing; a generator to generate an electromagnetic field so that the electromagnetic field is emitted from each of a plurality of portions of a tip of the housing; and a controller to control the generator to generate the electromagnetic field when the tip touches a surface of the display apparatus so that the display apparatus detecting the electromagnetic field erases an image within a preset image deletion region with a predetermined area based on a position on the surface touched by the tip, wherein the generator adjusts output of the electromagnetic field from each portion of the tip based on whether each portion of the tip touches the surface so that the display apparatus adjusts the area of the image deletion region based on the portion of the tip touched by the surface.
US09898106B2	Information processing system, information processing apparatus, and information processing method An information processing system includes a touch pad; a display unit; and a processing unit configured to move a cursor shown on a screen of the display unit, depending on an amount of movement and a movement direction of a contact point of a finger of an operator on the touch pad. The processing unit differentiates an amount of movement of the cursor with respect to the amount of the movement of the contact point, for a case where the number of the contact points on the touch pad is one, and for a case where the number of the contact points on the touch pad is two or more.
US09898104B2	Electronic terminal, input correction method, and program An information processing apparatus that includes a first sensor that receives a first signal; a second sensor that receives a second signal; and circuitry that calculates a position of a source from which the first signal and the second signal are transmitted based on a first time at which the first signal is received at the first sensor and a second time at which the second signal is received at the second sensor, and controls a display to display an image corresponding to a path obtained based on calculated changes in position of the source.
US09898103B2	Interacting tips for a digitizer stylus A stylus for use with a digitizer sensor includes a housing confined by a first and second end, a primary tip positioned at the first end of the housing and associated with a first transmitting element, the first transmitting element having a first diameter, a secondary tip positioned at the second end of the housing and associated with a second transmitting element, the second transmitting element having a second diameter that is larger than the first diameter, a transmitting unit for transmitting a first signal with a first amplitude via the first transmitting element and for transmitting a second signal with a second amplitude via the second transmitting element, wherein the first amplitude is at least twice the second amplitude and a powering unit for powering transmission of the first and second signal.
US09898074B2	Scanning depth engine Mapping apparatus includes a transmitter, which emits a beam comprising pulses of light, and a scanner, which is configured to scan the beam, within a predefined scan range, over a scene. A receiver receives the light reflected from the scene and to generate an output indicative of a time of flight of the pulses to and from points in the scene. A processor is coupled to control the scanner so as to cause the beam to scan over a selected window within the scan range and to process the output of the receiver so as to generate a 3D map of a part of the scene that is within the selected window.
US09898065B2	Wake-up circuit for a security device An exemplary security device includes a reader configured to read information stored on a credential device. The reader enters a sleep mode when not reading a credential device. A wake-up module includes an inductively coupled resonant circuit. The wake-up module is configured to detect a credential device near the reader if the credential device has a resonant frequency corresponding to a frequency of an electromagnetic field of the inductively coupled resonant circuit that is controlled by a stable oscillator. The wake-up module is configured to provide an indication to wake-up the reader from the sleep mode responsive to detecting a change in power of the electromagnetic field caused by the credential device.
US09898062B2	Systems and methods for protection of components in electrical power delivery systems Various embodiments disclosed herein provide protection to monitored equipment at both a local level and a system level, in order to offer more comprehensive protection. In one particular embodiment, the protected equipment may include one or more generators. The protection system may utilize time-synchronized data in order to analyze data provided by systems having disparate sampling rates, that are monitored by different equipment, and/or equipment that is geographically separated. Various embodiments may be configured to utilize a variety of sampling rates.
US09898061B2	Resource capacity management in a cluster of host computers using power management analysis A resource management system and method for performing resource capacity management in a cluster of host computers uses a snapshot of the cluster with one or more ghost host computers added to the cluster to execute a power management analysis. A ghost host computer is a fictitious construct based on a physical host computer. The results of the power management analysis may then be used as a cluster capacity recommendation to increase resource capacity of the cluster of host computers.
US09898057B2	Fan fixing device A device for fixing a heat dissipation fan in a computer includes a cage, a handle, and a movable portion. The handle is rotatably fixed on the cage, the handle has a pushing pole and holes are defined at each distal end. The movable portion is movably and elastically connected to the cage. The movable portion includes a plate with opposite ends, a sloping sheet connected with the plate at one end, and a protrusion extending from the plate at the same end as the sheet.
US09898054B2	Near zero force grounding feature An electronic device can include first and second housing components and an electrical grounding feature located therebetween to provide a grounding path. The grounding feature can include an outer portion formed from an electrically conductive material and an internal region containing a removable expansion element. The grounding feature can exert an expansion force against the housing components when the device is assembled and the expansion element remains, and exert no expansion force against the housing components when the expansion element is removed. The device can also include an adhesive coupling the electrical grounding feature to the housing components, which adhesive can be electrically conductive. The expansion element can be deformable and removable from an open end of the grounding feature outer portion, which outer portion can be elastic and can deform to contact more of the housing components when the grounding feature is compressed therebetween.
US09898052B2	Positioning structure for touch display device and touch display device The present disclosure relates to a positioning structure for touch display device and a touch display device. The touch display device comprises a touch glass, at least a positioning structure, and at least an optomechanical module. The positioning structure is used for positioning the optomechanical module to the touch glass. The positioning structure has at least a positioning member, which has a fixing part and a clamping part. The fixing part is clamped to the touch glass; the clamping part is provided for disposing the optomechanical module. The positioning structure according to the present disclosure allows direct assembly of the optomechanical module. In the assembling process, no other jointing means is required. Thereby, assembling easiness and speed can be well improved.
US09898050B2	Connection device and an apparatus A connection device for an apparatus includes a first rotation shaft, a second rotation shaft, a synchronization bulk, and a guide bulk. The first rotation shaft includes a first synchronization section set with a first groove; the second rotation shaft is in parallel with the first rotation shaft and includes a second synchronization section set with a second groove. The synchronization bulk includes a first end, a second end disposed opposite the first end, and a position limitation section, with the first end being disposed within the first groove and capable of sliding within the first groove, the second end being disposed within the second groove and capable of sliding within the second groove; the guide bulk being set with a first containing groove, a second containing groove, and a guide groove containing groove.
US09898040B2	Configurable dock storage A docking scheme enables storage systems to adapt different storage configurations to different clients. Dock configurations identify reconfigurable sets of storage extensions for executing storage operations in a resource node. The resource node receives storage requests from clients and identifies the dock configurations associated with the clients. The resource node then generates a set of storage operations that implement the storage extensions for the identified dock configuration and uses the storage operations to execute the storage requests. Different clients may thus access the same stored data through different docks resulting on different operations within the resource node with the aim of optimizing performance for all clients.
US09898031B1	Clutch pedal extender A clutch extender which is positioned between the free end of a clutch pedal arm and a clutch pedal.
US09898028B2	Low voltage, highly accurate current mirror Certain aspects of the present disclosure generally relate to a low voltage, accurate current mirror, which may be used for distributed sensing of a remote current in an integrated circuit (IC). One example current mirror typically includes a first pair of transistors, a second pair of transistors in cascode with the first pair of transistors, a switching network coupled to the second pair of transistors, and a third pair of transistors coupled to the switching network. An input node between the first and second pairs of transistors may be configured to receive an input current for the current mirror, and an output node at the first pair of transistors may be configured to sink an output current for the current mirror, proportional to the input current. This current mirror architecture offers a hybrid low-voltage/high-voltage solution, tolerates low input voltages, provides high output impedance, and offers low area and power consumption.
US09898021B2	Dual-mode regulator circuit The present disclosure illustrates a dual-mode regulator circuit comprising: a first output terminal; a second output terminal; a switching regulator circuit coupled to the first output terminal and comprising a first transistor coupled between the first output terminal and ground; a linear regulator circuit coupled to the second output terminal and comprising a second transistor coupled between the second output terminal and a power source; a detection circuit configured to turn on the first transistor in order to connect the first output terminal to ground, turn on the second transistor in order to connect the second output terminal to the power source, and then generate a detection signal indicating whether an inductor is connected between the first and second output terminals; and a logic circuit configured to activate the switching regulator circuit or the linear regulator circuit according to the detection signal.
US09897999B2	Setting operation control in parts mounting device by reducing a variation of a distance value A technology is provided to enable lowering the fault generation rate related to a parts installation device. A parts installation device (100) (calculation device (150)) fetches or calculates state parameter values that represent the relative position relationship or the distance of a part holder and a part during the operation of removing and holding, calculates the fluctuation values of the state parameters, and corrects parameters having a small increase in the cycle time and is effective in reducing fluctuations among the parameter values of the holding position of the part holder, stop time, operating speed, and operation acceleration when the value of the fluctuations exceeds a first threshold.
US09897995B2	Positional applicator device for use with stretchable electronic devices and related methods Positional applicator devices and methods are for application of stretchable electronics relative to subsurface features of an object. In some embodiments, a positional applicator device for applying a stretchable electronic device to a surface of an object includes: a holder for a stretchable electronic device; a signal emitter positioned to direct an emitted signal toward a surface of an object; a receiver positioned to detect a return signal from the surface of the object; circuitry operably connected to the signal emitter and the receiver, the circuitry configured to compare the emitted signal with the return signal in order to identify surface and subsurface features of the object; circuitry configured to compare the identified features with a map of surface and subsurface features of the object stored in memory; and a positioner, the positioner structured to apply the stretchable electronic device to a position on the surface of the object.
US09897989B2	Method and system for utilizing a device's user location to monitor and control the device power usage An autonomous system for managing power distribution to an electrically-powered device that includes a power controller module that includes power input and power output abilities and operably connected power switching abilities, wherein the power switching is configured for actuation by an integral power management module operably connected thereto, the integral power management module including integral actuation signal detection and actuation abilities configured for, in accordance with commands and operational parameters, upon detection of an actuation signal, actuation the integral power switching to alter power output through the power output from a first output level to a second output level. The system further includes memory for storing the commands an operational parameters, and wherein the actual signal include an identification component for identifying an actuating signal, and wherein the integral actuation signal detection and actuation is configured for, upon detecting signals other than actual signals, reacting other than in response to the actuation signal.
US09897980B2	Drug delivery device A drug delivery device comprising; a housing; a cylindrical member configured to be rotatably supported inside the housing, wherein the outer surface of the cylindrical member is provided with a track comprising a sequence of encoded images; and a sensor directed at the track of the cylindrical member and configured to detect features of the encoded images.
US09897979B2	Electronic timepiece and control method of an electronic timepiece An electronic timepiece having a satellite signal receiver; a standard time signal receiver; a storage battery; a voltage detection circuit that detects the remaining capacity of the storage battery; a satellite signal reception controller; and a standard time signal reception controller. The satellite signal reception controller operates the satellite signal receiver when the battery capacity detected by the voltage detection circuit is greater than or equal to a first threshold and the automatic reception condition is met. The standard time signal reception controller operates the standard time signal receiver when the automatic reception condition for the standard time signal is met whether the reserve power is greater than or equal to the first threshold and when the reserve power is less than the first threshold.
US09897978B2	Case closure detection system for a portable object A portable object including a case middle closed by a back cover, in which an electronic module is placed, the electronic module including a plate to which a printed circuit board is secured, the printed circuit board carrying at least one contact area connected to at least one input of at least one integrated circuit, the integrated circuit supplying at least one signal to an electronic signal processing device. The portable object further includes a detection member changing from at least a first position, indicating that the back cover is secured to the case middle, to a second position, indicating that the back cover is not secured to the case middle.
US09897970B2	Developer container, developing device, process cartridge and image forming apparatus A developer container includes a frame, provided with an opening, for accommodating a developer; a sealing member, including a folded-back portion, for sealing the opening; and a sandwiching portion for sandwiching the folded-back portion of the sealing member. In a plane perpendicular to the opening, the sealing member is nonwelded in the sandwiching portion.
US09897968B2	Image forming apparatus An image forming apparatus is provided including an image forming unit configured to form an image on a print medium, and a printed medium post-processing unit configured to receive and post-process printed media on which an image forming process is completed from the image forming unit. The printed medium post-processing unit selectively comprises one of a first stacker module in which a first amount of post-processed printed media is able to be loaded, and a second stacker module in which a second amount of post-processed printed media is able to be loaded. Therefore, it may be possible to flexibly respond to a loading amount of the printed media necessary for the printed medium post-processing unit.
US09897965B2	Image forming device having a suction device An image forming device includes an image carrier, a charging device that charges the surface of the image carrier, an electrostatic image forming device that forms an electrostatic image on the surface of the image carrier, a developing device that uses a developer containing toner particles and external additives adhering to the surface of the toner particle to develop the electrostatic image into a toner image, a transfer device that transfers the toner image to a recording medium, a cleaning device having a blade that cleans off residual toner from the image carrier, a suction device that suctions all or part of residual toner excepting the external additives released from the surface of the toner particles, and a fixing device that fixes the toner image to the recording medium.
US09897962B2	Sheet processing device and image forming apparatus provided with the same A sheet pressing device of the present invention includes: a pair of pressing rollers 70 that press, in a fold thickness direction, a fold of a folded sheet bundle BS conveyed in a folded state; and a pressing roller unit 56 that moves the pressing roller pair in a sheet fold direction while supporting the same. The pressing roller pair 70 presses the fold in one of a first region R1 where rollers of the pressing roller pair 70 are brought into pressure contact with each other and a second region R2 adjacent to the first region R1 on an upstream side thereof where rollers of the pressing roller pair 70 are opposed to each other at an interval. With this configuration, it is possible to minimize damage on a sheet end portion and reduce a moving load of the pressing roller pair 70.
US09897961B2	Image forming apparatus provided with transmission mechanism capable of interrupting transmission of rotational force to reconveying roller An image forming apparatus includes: an image-forming mechanism; a reconveying roller; an electric motor; and a transmission mechanism. The transmission mechanism is configured to operate in one of a reverse-rotation transmission mode for reversing a direction of a rotational force received from the electric motor to transmit the reversed rotational force to the reconveying roller and a normal-rotation transmission mode for transmitting the rotational force to the reconveying roller without reversing the direction of the rotational force. The transmission mechanism includes an interrupting unit for interrupting transmission of a rotational force from the reconveying roller to the electric motor at least when a sheet is being conveyed in the image-forming mechanism. The transmission mechanism is configured to interrupt transmission of the rotational force received from the electric motor to the reconveying roller when a sheet is being conveyed in the image-forming mechanism.
US09897957B2	Image forming apparatus and color tone density controlling method thereof A method of controlling a color-tone density (CTD) of an image forming apparatus including a plurality of developers configured to circularly perform a developing operation. The method includes developing test patches on an OPC sequentially from a developer to be developable preferentially, measuring CTDs of the developed test patches, and controlling a development variable using the measure CTDs.
US09897955B2	Pressure member, fixing device, and image forming apparatus A fixing device includes a rotatably-supported first fixing member and a second fixing member pressed against the first member. The second member includes a belt-shaped component, a support component, and a pressing component. The belt-shaped component extends in a width direction of a medium passing through a contact region between the belt-shaped component and the first member. The support component is disposed opposite the first member with the belt-shaped component interposed therebetween. The pressing component has a base end supported by the support component and a free end extending toward the contact region and presses the belt-shaped component against the first member. The pressing component has biasing portions arranged apart in the width direction and elastically deformable in correspondence with the medium thickness. The biasing portions are connected in the width direction by the free end. The free end is disposed at an upstream side in a medium transport direction.
US09897946B2	Roller member including a first and second high resistance member and image forming apparatus including the roller member A roller member includes a cored bar, an elastic layer, a first high resistance member, and a second high resistance member. The elastic layer is disposed on an outer circumferential face of the cored bar. The cored bar has a projecting portion projecting beyond a range in which the elastic layer is disposed, toward an axial end of the cored bar. The first high resistance member is made of a high-resistance material having a higher electrical resistance than an electrical resistance of the cored bar. The first high resistance member is fitted to the projecting portion. The second high resistance member is made of a high-resistance material having a higher electrical resistance than an electrical resistance of the cored bar. The second high resistance member fills a space between the first high resistance member and the elastic layer.
US09897937B2	Development cartridge and electrophotographic image forming apparatus using the same A development cartridge attachable to and detachable from a main body of an image forming apparatus includes a photosensitive unit including a photosensitive drum, a developing unit including a developing roller and rotatably coupled to the photosensitive unit with respect to a hinge axis, a driving gear configured to rotate in a first direction for a printing operation or a second direction opposite the first direction, a driving member positioned coaxially with the driving gear and configured to be rotated by the driving gear, a first one-way clutch configured to connect the driving member with the driving gear only when the driving gear rotates in the second direction, and a first moving member configured to be connected to the driving member so as to reciprocate between a first location where a development nip is formed and a second location where the development nip is released.
US09897935B2	Image forming method, electrostatic charge image developer set, and image forming apparatus An image forming method forms a color toner image and a white toner image using an image forming apparatus having a plurality of developing machines. The color toner image is formed using a color developer containing a first carrier and at least one color toner selected from a yellow toner, a magenta toner, and a cyan toner. The white toner image is formed using a white developer containing a second carrier and a white toner containing at least titanium oxide as a pigment. Formula (1): Iw
US09897932B2	Toner A toner comprising: a toner particle containing a toner base particle containing a binder resin and a colorant, and a resin particle fixed to a surface of the toner base particle; and an inorganic fine particle A, wherein the surface of the toner particle has protruded portions originating in the resin particle, an average length (D) of long sides of the protruded portions is 50 nm to 300 nm, an average Height (H) of the protruded portions is 25 nm to 250 nm, the average long-side length and the average height of the protruded portions satisfies a specific relationship, and an average value of a compactness of the inorganic fine particle A is 0.40 to 0.80, and the attachment rate of the inorganic fine particles A is 0.1% to 5.0% by area.
US09897927B2	Device and method for positioning a photolithography mask by a contactless optical method A device for positioning a mask relative to the surface of a wafer with a view to the exposure of the wafer, which includes (i) first positioning structure suitable for holding and moving the mask and the wafer in relation to each other; (ii) imaging structure suitable for producing at least one image of the mask and of the surface of the wafer according to at least one field of view, so as to image positioning marks of the mask and of the wafer simultaneously in the field of view; and (iii) at least one optical distance sensor suitable for producing a distance measurement between the surface of the wafer and the mask in the field(s) of view, with a measurement beam which passes at least partially through the imaging structure.
US09897925B2	Method and device for monitoring multiple mirror arrays in an illumination system of a microlithographic projection exposure apparatus Microlithographic illumination system includes individually drivable elements to variably illuminate a pupil surface of the system. Each element deviates an incident light beam based on a control signal applied to the element. The system also includes an instrument to provide a measurement signal, and a model-based state estimator configured to compute, for each element, an estimated state vector based on the measurement signal. The estimated state vector represents: a deviation of a light beam caused by the element; and a time derivative of the deviation. The illumination system further includes a regulator configured to receive, for each element: a) the estimated state vector; and b) target values for: i) the deviation of the light beam caused by the deviating element; and ii) the time derivative of the deviation.
US09897920B2	Sensor for detecting saccharide and manufacturing method thereof and detection method of glycated hemoglobin using the same The present disclosure relates to a sensor for detecting saccharide and manufacturing method thereof and detection method of glycated hemoglobin using the same wherein the sensor for detecting saccharide includes a reactive layer synthesized with hydrogel having a boronic acid-modified 3D mesh structure. A selective and sensitive detection of the glycated protein including glucose or glycated hemoglobin (HbA1c) in blood through high level of signal may be enabled, and the durability of the sensor for detecting saccharide may be enhanced.
US09897906B2	Projection screen A projection screen includes a plurality of projection plates and at least one fixing component. Each of the projection plates has a projection surface and at least one connection side. Through the connection sides, the projection surfaces of the projection plates lean against each other to be coplanar. The fixing component includes two fixing sections connected with each other, wherein the two connection sides leant against each other are clipped at the two fixing sections, respectively.
US09897905B2	Head-up display for displaying an image on a combiner capable of being self-returned to an original position A head-up display includes a case main body formed with an opening part, a combiner capable of closing the opening part, a combiner drive unit including a drive device and a spring, and a projection unit. The combiner, the combiner drive unit and the projection unit are accommodated inside the case main body. The combiner drive unit is integrally provided with a second turnable shaft and a bearing turnably supporting the second turnable shaft is provided in a base part fixed to the case main body so as to be turnable with respect to the base part. A first spring for urging the bearing with respect to the base part in one direction is provided between the base part and the bearing. A second spring for urging the combiner drive unit with respect to the bearing in an opposite direction is provided between the bearing and the combiner drive unit.
US09897904B2	Light source device, dust collecting member, and projector A light source which has a housing accommodating a light source lamp and having an exhaust port, a duct, and a fan are provided. The duct has an inlet facing the exhaust port, a branching part which branches air from the inlet, a duct part extending in a first direction orthogonal to an opening plane of the exhaust port, and a duct part extending in a second direction intersecting with the first direction. The fan is arranged in a position for sucking the air circulating through the duct part. The duct part has a plurality of sidewall parts, an opening, and a mesh.
US09897903B2	Light source system and related projection system A light source system comprises: a light-emitting device for emitting a first light and a second light in sequence; a beam splitting system with which the first light is divided into one beam in a first range of wavelength and the other beam in a second range of wavelength, respectively emitted along a first optical path and a second optical path, and also with which at least a part of the second light is emitted along the first optical path; a first spatial light modulator for modulating the beam emitted from the beam splitting system along the first optical path; a second spatial light modulator for modulating the beam emitted from the beam splitting system along the second optical path. The light source system has the advantages of high light-emitting efficiency and low cost. A projection system comprising the aforementioned light source system is also provided.
US09897898B2	Quick-reposition camera support A quick-reposition camera support and method for photography of record in turbulent conditions, providing adjustable stability, controlled dropping, and quick recovery and repositioning after drops, allowing nearly continuous photography.
US09897896B2	Protective case for electronic camcorders for air, land and underwater use employing dual lens covers A protective case for electronic camera/camcorders for air, land and underwater use employing a discardable, dispensable second lens cover within a second surrounding lens cover frame in overlying protection of a first clear lens cover within a first surrounding lens cover frame incorporated within a front surface of the protective case.
US09897895B2	Method for controlling a camera module, and associated camera module The present disclosure provides a control method for a camera module. The camera module comprises an imaging module, a sleeve module, a lens module which is mounted in the sleeve module and can move along an optical axis direction relative to the sleeve module, at least one coil, at least one magnetic component, and elastic components disposed between the lens module and the sleeve module. The method comprises: pressing the elastic components against the lens module, wherein a deformation of the elastic components perpendicular to the optical axis direction applies a radial positive pressure to the lens module, a frictional force in the optical axis direction is generated by the positive pressure on a contact surface of the elastic components and the lens module so that the frictional force can keep the lens module in a static state in the optical axis direction relative to the elastic components; and supplying current to the at least one coil, wherein the at least one coil or the at least one magnetic component optionally matches the lens module, and the lens module is subject to an electromagnetic force in the optical axis direction, the electromagnetic force acting as a driving force for the lens module to do rectilinear motion along the optical axis direction so as to drive the lens module to move.
US09897888B2	Spacers for insulated glass units This disclosure provides spacers for smart windows. In one aspect, a window assembly includes a first substantially transparent substrate having an optically switchable device on a surface of the first substrate. The optically switchable device includes electrodes. A first electrode of the electrodes has a length about the length of a side of the optically switchable device. The window assembly further includes a second substantially transparent substrate a metal spacer between the first and the second substrates. The metal spacer has a substantially rectangular cross section, with one side of the metal spacer including a recess configured to accommodate the length of the first electrode such that there is no contact between the first electrode and the metal spacer. A primary seal material bonds the first substrate to the metal spacer and bonds the second substrate to the metal spacer.
US09897887B2	Electrochromic device capable of preventing damage of electrode Provided is an electrochromic device, which may prevent a damage of an electrode and include a lower substrate and an upper substrate configured to face each other with an electrolyte layer therebetween, an upper electrode provided between the electrolyte layer and the upper substrate, a lower electrode provided between the electrolyte layer and the lower substrate, an upper ion reactive layer provided between the upper electrode and the electrolyte layer, and a lower protection layer provided between the lower electrode and the electrolyte layer and configured to prohibit the lower electrode and the electrolyte layer from contacting.
US09897883B2	Liquid crystal display A liquid crystal display includes a first substrate that includes a first switching element and first electric field forming electrodes that form a first electric field based on on/off signals received from the first switching element, a second substrate which faces the first substrate and that includes a second switching element and second electric field forming electrodes that form a second electric field b on/off signals received from the second switching element, and a liquid crystal layer interposed between the first substrate and the second substrate, wherein the liquid crystal layer includes a first electric field area controlled by the first substrate in which the first electric field is formed, and a second electric field area controlled by the second substrate in which the second electric field is formed, and wherein the first electric field area and the second electric field area are arranged side by side.
US09897882B1	Methods of fabricating COA type liquid crystal display panels and COA type liquid crystal display panels The present application provides a method of fabricating a COA type liquid crystal display panel and the COA type liquid crystal display panel, which utilizes reactive liquid crystal, reactive monomers, red quantum-rods and green quantum-rods to fabricate a color filter thin film. Due that light generated by the red and green quantum rods in the color filter thin film when they are excited are polarized light, and the red and green quantum rods therein are arranged along the same direction, the excited red and green quantum rods generate red and green linear polarized light conforming to the polarized direction so as to play a role of a lower polarizer and to allow the COA type liquid crystal display panel fabricated by the method not only obtain bright trichromatic light for increasing color saturation, but also omit the lower polarizer for reducing fabrication cost.
US09897865B2	Array substrate, method of manufacturing the same, and liquid crystal display panel An array substrate, a method of manufacturing the same and a liquid crystal display panel are disclosed. In the array substrate, a connection part for connecting two adjacent pixel electrodes is configured to enclose the spacer from three sides and a corresponding thin film transistor is arranged to enclose the spacer from a side other than the three sides. A distance between an upper surface of the connection part and an upper surface of the base substrate is larger than a distance between a lower surface of the spacer and the upper surface of the base substrate. With this configuration, the spacer is limited within a position limiting structure formed by the connection part and the thin film transistor.
US09897863B2	Array substrate, display panel and display apparatus having recesses on data lines or gate lines An array substrate, a display panel and a display apparatus are disclosed. The array substrate includes a plurality of gate lines (10; 50) and a plurality of data lines (30; 51), and pixel units arranged in an array. Each of the pixel units includes one pixel electrode (41; 42) and one thin film transistor, the data line (30; 51) serve as a source electrode (31; 311) of the thin film transistor, the gate line (10; 50) serve as a gate electrode (11) of the thin film transistor, and a drain electrode (32; 321; 322) of the thin film transistor is electrically connected to the pixel electrode (41; 42), at least one of the gate lines (10; 50) and the data lines (30; 51) has a recess (363; 364) provided thereon aligned with a spacer for fixing. With the recess (363; 364), the post spacer is prevented from moving to affect the display region when the substrate is bent and deformed under an external pressure.
US09897857B2	Liquid crystal display device, polarizer and protective film Provided is a liquid crystal display device that has excellent visibility while using a protective film comprising a polyester film. The liquid crystal display device comprises a backlight light source, and a liquid crystal cell disposed between two polarizers; the backlight light source being a white light-emitting diode; each of the polarizers comprising a polarizing film and protective films laminated on both sides of the polarizing film; and at least one of the protective films being a polyester film having a retardation of 3,000 to 30,000 nm.
US09897853B2	Backlight module and display device The present invention provides a backlight module, comprising a glue frame, a light guide plate and a backlight source, wherein the glue frame comprises two opposite side walls and end walls connecting with the two side walls, and a loading plate is located at an inner side of the end wall, and a limiting plate is connected between the two side walls, and the limiting plate and the loading plate are respectively located at two opposite sides of the light guide plate, and the light guide plate comprises an incident surface, a limiting block and a limiting slot, and the limiting block and the limiting slot are respectively located on two opposite surfaces of the light guide plate and close to one end of the light guide plate provided with the incident surface. The present invention further provides a display device.
US09897845B2	Display A display is provided which includes: a first substrate; gate lines and data lines; transistors respectively located in pixel areas, wherein each of the transistors includes: an active layer on the first substrate and having a first end portion, a second end portion, and a necked-down portion connecting the first and the second end portions; a second substrate on the first substrate; and a display medium between the first substrate and the second substrate.
US09897837B2	Mobile terminal A mobile terminal includes a middle frame, a plastic frame, a backplane, and a display module including a display panel and a backlight module. The plastic frame includes a first frame and a second frame. Two opposite sides of the backlight module respectively abut the first frame and the second frame such that the backlight module is received in the plastic frame. The backplane carries the backlight module and plastic frame. The middle frame surrounds the plastic frame and the display module. The middle frame, the plastic frame and the backplane are formed integrally as a case. The present mobile terminal omit the plastic frame and the backplane to realize slim effect, narrow frame and frameless for the mobile terminal. Besides, an assembly for the display module, the plastic frame and the backplane are omitted to simplify the assembly process and reduce the production cost.
US09897836B2	Display device comprising a bottom chassis having a hemming unit overlapping a support bent from a bottom member A display device includes: a display panel; a bottom chassis accommodating the display panel and including a bottom member, a support bent from the bottom member, and a hemming unit overlapping the support; and a mold frame coupled to the bottom chassis and including a projection. The bottom chassis may have a coupling hole into which the projection is inserted and have a bent member extending from a side of the coupling hole.
US09897820B2	Image projection apparatus An image projection apparatus includes an optical modulation element, a lighting optical unit, a projection unit, and a shifting unit. The optical modulation element generates an image from light emitted from a light source. The lighting optical unit is configured to guide the light emitted from the light source to the optical modulation element. The projection unit projects the image generated by the optical modulation element. The shifting unit relatively shifts the optical modulation element with respect to the lighting optical unit. The shifting unit also generates driving forces to shift the optical modulation element, respectively, in a vertical direction, in a direction of being inclined by a first angle less than 90 degrees with respect to the vertical direction, and in a direction of being inclined by a second angle less than 90 degrees in an opposite side of the first angle.
US09897818B2	Ocular frame for stereoscopic image viewer A stereoscopic image viewer comprises a frame to be physically coupled to a handheld electronic device. The frame comprises a face plate having a pair of lens sockets with a pair of lenses, and a pair of side arms with a pair of slots to receive the handheld electronic device. The lenses can be coupled in the sockets by twist-to-lock couplings. A forehead pad comprising a squat dome is disposed on the face plate.
US09897804B2	Liquid crystal lens A crystal lens includes a liquid crystal layer, a pair of alignment layers, a first electrode set, and a second electrode set. The alignment layers are positioned on different sides of the liquid crystal layer. The first and second electrode sets are positioned on different alignment layers. The first electrode set includes a first transparent insulating layer and a first electrode layer. The first electrode set attaches to one of the alignment layers. The second electrode set includes a second transparent insulating layer, a second electrode layer, and a dielectric film. The second electrode layer includes a hole-patterned electrode. The dielectric film attaches to the first transparent insulating layer. The hole-patterned electrode exposes the dielectric film. In addition, an external power supply provides a driving voltage to the hole-patterned electrode and the first electrode layer, so that the liquid crystal molecules inside the liquid crystal layer drive rotation.
US09897802B2	Image pickup apparatus and image pickup unit having device for removing foreign substance deposited on surface of optical member An image pickup unit integrally includes an optical lowpass filter, a piezoelectric element, and an image pickup element. The optical lowpass filter is separated into a plurality of grouped optical members in an imaging light axis direction. The optical lowpass filter includes first to third grouped optical members. To remove a foreign substance, such as dust or dirt, deposited on the surface of the first grouped optical member, the piezoelectric element vibrates the first grouped optical member. The first grouped optical member has a monocrystalline structure having a Q value indicating the sharpness of resonance higher than that of glass, which is an amorphous material, and a low attenuation characteristic so as to efficiently vibrate the first grouped optical member.
US09897798B2	Electro-optical device, method of manufacturing electro-optical device, and electronic apparatus An electro-optical device is configured by a laminated body of a second conductive layer and a reflective layer for a mirror. The second conductive layer includes a mirror support post facing a concave portion at a side opposite to a substrate, and a flat plate which extends from an end portion of the mirror support post and faces the substrate. The concave portion is filled with the resin. Surfaces of the flat plate and the resin configure a continuous plane. The reflective layer for a mirror is laminated on a surface of the resin at a side opposite to the substrate, and a surface of the flat plate of the second conductive layer at a side opposite to the substrate.
US09897791B2	Optical scanning systems for in situ genetic analysis Presented herein are systems and methods for performing sequencing, including fluorescence in situ sequencing. In one embodiment, a confocal time delay and integration (TDI) line scan imaging system may include various pinhole and/or slit aperture mechanisms in front of the image sensor. The system may also include structures with focusing strips on a substrate in contact with the tissue sample to be imaged. Alternatively, these strips may be cut into the tissue sample. The system may also include configurations and methods of placing a tissue sample inside a reaction chamber of a flow cell during the assembly of the flow cell and then performing chemistry operations on the tissue sample. The flow cells may use an open container for performing chemistry operations on the tissue sample.
US09897787B2	Telecentric optical lens A telecentric optical lens (100), comprising a first lens (L1) to a fifth lens (L5) arranged sequentially and co-axially along the direction of transmission of the incident light ray; the first lens (L1) is a plano-concave negative lens; the second lens (L2) is a meniscus negative lens; the third lens (L3) is a meniscus negative lens; the fourth lens (L4) is a biconvex positive lens; and the fifth lens (L5) is a plano-concave negative lens; the arrangement and design parameters of the first lens (L1) to the fifth lens (L5) of the telecentric optical lens (100) allow said telecentric optical lens (100) to achieve a telecentric effect, and simultaneously satisfy achromatic and relatively large aperture requirements.
US09897781B2	Optical image capturing system An optical image capturing system includes, along the optical axis in order from an object side to an image side, a first lens, a second lens, a third lens, a fourth lens, a fifth lens, a sixth lens, and a seventh lens. At least one lens among the first to the sixth lenses has positive refractive force. The seventh lens have negative refractive force, wherein both surfaces thereof can be aspheric, and at least one surface thereof has an inflection point. The lenses in the optical image capturing system which have refractive power include the first to the seventh lenses. The optical image capturing system can increase aperture value and improve the imagining quality for use in compact cameras.
US09897778B2	Four-surface narrow field-of-view compound lens A four-surface narrow field-of-view compound lens includes a first biplanar substrate between a first lens and a second lens, the first lens being plano-convex and the second lens being plano-concave. The compound lens also includes a second biplanar substrate between a third lens and a fourth lens, the third lens being plano-convex and the fourth lens being plano-concave. The second lens and third lens are between the first biplanar substrate and the second biplanar substrate. The first lens, second lens, third lens, and fourth lens are coaxial and are formed of materials having a first, second, third, and fourth Abbe number respectively and focal lengths F1, F2, F3, and F4 respectively. The first Abbe number exceeds the second Abbe number and the third Abbe number exceeds the fourth Abbe number. Ratio F1/F2 may satisfy −0.32
US09897777B2	Optical system There is provided an optical system including: a first lens having positive refractive power; a second lens having positive refractive power; a third lens having refractive power and having a convex object-side surface; a fourth lens having refractive power; and a fifth lens having refractive power, wherein the first to fifth lenses are sequentially disposed from an object side, whereby spherical aberration and coma aberration may be improved to realize high resolution in images captured thereby and increase an amount of light incident through the lenses to an image sensor.
US09897774B2	Lens unit and imaging device First and second lens drive sections of the lens unit are disposed at positions where a center point connecting line, which connects center positions of the lens drive sections on a plane perpendicular to a lens axis, does not pass through the lens axis; and include yokes, voice coils, and plate-like magnets. The width of the magnet in a lens circumferential direction is smaller than the width of the yoke; and the magnets are disposed to be biased to end portions of the yokes, which are positioned in a divided area in which a lens axis center is present, of divided areas divided into two by a center point connecting line, in the lens circumferential direction, respectively. The shortest distance between an operating point connecting line is shorter than the shortest distance between the center point connecting line and the lens axis.
US09897768B2	Optical fiber module An optical fiber module has a package housing having an internal space defined by a base plate, a side wall, and a cover member, a laser device disposed on the base plate within the internal space, an optical fiber that transmits a laser beam emitted from the laser device to an outside of the package housing, a light scattering member that scatters light having a wavelength of the laser beam and covers an outer circumferential surface of the projecting end of the optical fiber, and a heat dissipation portion disposed on the base plate. The optical fiber has a projecting end projecting from an inner surface of the side wall toward the internal space. The heat dissipation portion covers a portion of an outer circumferential surface of the light scattering member and exposes another portion of the outer circumferential surface of the light scattering member to the internal space.
US09897759B2	Apparatus for combining optical radiation An apparatus for combining optical radiation, wherein the apparatus comprises a bundle of input optical fibers formed of glass, a taper, and an output optical fiber, wherein the taper is fused to the output optical fiber; and the apparatus comprises at least one cladding mode stripper to strip out higher order modes that would otherwise degrade a polymer coating on at least one of the input optical fibers and the output optical fiber.
US09897758B2	Optical circulators integrated into transceivers An optical circulator integrated into a transceiver for bi-directional communication may include a core configured to pass a transmission signal in a transmit direction and a received signal in a receive direction. The optical circulator may include an input port optically coupled to the core. The input port may be configured to deliver the transmission signal to the core. The optical circulator may include an output port optically coupled to the core. The output port may be configured to receive the received signal from the core. The optical circulator may additionally include a network port optically coupled to the core. The network port may be configured to receive the transmission signal from the core and deliver the transmission signal to a fiber optic cable. The network port may be configured to receive the received signal from the fiber optic cable and deliver the received signal to the core.
US09897751B2	Multicore polarization-maintaining fiber A multicore polarization-maintaining fiber 10 includes a plurality of cores 11, a cladding 12 surrounding the plurality of cores 11, and a plurality of stress applying parts 15 provided sandwiching the plurality of cores 11 in a region surrounded by the outer circumferential surface of the cladding 12. The cross sectional area of the stress applying part 15 is greater than the cross sectional area of the core 11. Stress applying parts 15 of the plurality of stress applying parts 15 are disposed in a first direction, and stress applying parts 15 of the plurality of stress applying parts 15 are disposed in a second direction different from the first direction.
US09897739B2	Optical film, backlight module, and display device Provided are an optical film and a backlight module. The backlight module includes a backboard, a light guide plate and the optical film. The backboard includes a bottom plate and two side plates mounted to the bottom plate having outside surfaces. The optical film includes a first film layer and a second film layer stacked on the first film layer. The first film layer has two opposite lateral edges including positioning tabs extending therefrom in a direction away from the first film layer. The light guide plate and the optical film are mounted on the backboard. The optical film is positioned on the light guide plate with the second film layer engaging the light guide plate. The positioning tabs cover surfaces of the side plates distant from the bottom plate and is folded to attach to the outside surfaces of the side plates. A display device is also provided.
US09897736B2	Lighting device having light guide with helically-shaped input portions The lighting device includes at least two light sources; at least two input guides coupled to the light sources; and a light collector coupled to the light-sensing guides. Each of the input guides has an input end facing the corresponding light source, and an output end tangentially coupled to the light collector such as to lead a light beam from the corresponding light source into the collector. The input guides are helically-shaped between the input and the output ends.
US09897729B2	Photosensitive resin composition for color filter and application thereof The present invention relates to a photosensitive resin composition for color filter and application thereof. The aforementioned photosensitive resin composition includes an alkali-soluble resin (A), a compound having a vinyl unsaturated group (B), a photo-initiator (C), an organic solvent (D), and a pigment (E). The alkali-soluble resin (A) is obtained by copolymerizing a vinyl unsaturated monomer having a carboxylic group (a1), a vinyl unsaturated monomer having a silane group (a2), a vinyl unsaturated monomer having an oxetanyl group (a3) and an other copolymerizable vinyl unsaturated monomer (a4).
US09897724B2	Optical device and method of in situ treating an EUV optical component to enhance a reduced reflectivity The present invention relates to an optical device and a method of in situ treating an optical component (2, 6, 13) reflecting EUV and/or soft X-ray radiation in said optical device, said optical component (2, 6, 13) being arranged in a vacuum chamber (14) of said optical device and comprising one or several reflecting surfaces (3) having a top layer of one or several surface materials. In the method, a source (1, 5) of said one or several surface materials is provided in said chamber (14) of said optical device and surface material from said source (1, 5) is deposited on said one or several reflecting surfaces (3) during operation and/or during operation-pauses of said optical device in order to cover or substitute deposited contaminant material and/or to compensate for ablated surface material.
US09897723B2	Starshade with attributes facilitating assembly An exemplary starshade comprises a tensegrity truss structure having a central hub with radially extending, telescoping booms. Telescoping tension struts connected to the central hub and booms provide a compressive force on the booms during final truss deployment. Opaque petals, not supported by the tensegrity truss structure prior to its final deployment, are each sequentially placed on and attached to the tensegrity truss structure in side by side position to form a concentric ring of petals spaced apart from the central hub. A fan fold covering, not supported by the tensegrity truss structure prior to its final deployment, is placed on and attached to the tensegrity truss structure to form an opaque, concentric inner ring about the central hub. An outer edge of the inner ring is adjacent an interior edge of the concentric ring of petals to block light from the petals to the central hub.
US09897722B2	Optically diffusive plastic having high stiffness An optically diffusive plastic can comprise 40 to 94.9 mass % of a polymer resin matrix; 5 to 50 mass % of a glass filler; and 0.1 to 10 mass % of a light diffusing component; wherein the difference between refractive index of the polymer resin matrix and refractive index of the glass filler is less than or equal to 0.02; wherein a 1 millimeter (mm) thick sample of the optically diffusive plastic comprises a DLD value of greater than or equal to 1 degree (°) as measured by goniophotometry; wherein the 1 mm thick sample comprises a total transmittance of greater than or equal to 40% for incident light having a wavelength of 360 nanometers (nm) to 750 nm in air; and wherein a 3.2 mm thick sample of the optically diffusive plastic comprises a flexural modulus, measured at 23° C., of greater than or equal to 2,500 Megapascal (MPa).
US09897718B2	Neutron-absorbing gamma ray window in a downhole tool Methods and downhole tools involving neutron-absorbing gamma ray windows are provided. One such method involves emitting neutrons from a neutron source in a downhole tool in a well into a surrounding geological formation. This may produce formation gamma rays through interactions between the neutrons and elements of the geological formation. The formation gamma rays may be detected by a gamma ray detector when the gamma rays pass via a gamma ray window that includes a neutron-absorbing material disposed in a substrate material of the downhole tool. The gamma ray window may be both more transmissive of gamma rays than the substrate material and less transmissive of neutrons than a window without the neutron-absorbing material. This may decrease a neutron flux that would otherwise reach the gamma ray detector and the tool materials surrounding it and thus would otherwise lead to a background signal contaminating a signal corresponding to the detected formation gamma rays.
US09897717B2	Neutron through-pipe measurement, device, system and use thereof A method for evaluating a characteristic of a formation adjacent a wellbore comprises emitting a neutron field into the formation from a neutron source, obtaining data comprising a long neutron neutron (LNN), short neutron neutron (SNN), long neutron gamma (LNG) and short neutron gamma data (SNG) from the neutron field emitted into the formation and combining the long data with the short data to reduce error associated with the characteristic to be evaluated. A detector for evaluating a characteristic of a formation includes a neutron source and detectors for detecting LNN, SNN, LNG, SNG.
US09897709B2	Imaging apparatus and radiographic imaging system An imaging apparatus includes a plurality of pixels arranged in a matrix form, each pixel being configured to generate an electric signal, and each being configured such that the electric signal can be read out nondestructively, an output amplifier configured to sequentially output electric signals read out nondestructively from the plurality of pixels, and a control unit configured to, in a period when electric signals for one frame of image data are being read out nondestructively from the plurality of pixels, execute nondestructive readout processing a plurality of times for reading out electric signals nondestructively from pixels in a first row, and execute nondestructive readout processing a plurality of times for reading out electric signals nondestructively from pixels in a second row adjacent to the first row. In this case, the control unit resets the output amplifier in a period when the nondestructive readout processing is performed a plurality of times on the pixels of the first row.
US09897705B2	Radiation detector, scintillator panel, and method for manufacturing the same According to the embodiment, a radiation detector includes a photoelectric conversion substrate converting light to an electrical signal and a scintillator layer being in contact with the photoelectric conversion substrate and converting externally incident radiation to light. The scintillator layer is made of a phosphor containing Tl as an activator in CsI, which is a halide. A concentration of the activator in the phosphor is 1.6 mass %±0.4 mass %, and a concentration distribution of the activator in an in-plane direction and a film thickness direction is within ±15%.
US09897696B2	Method of recognizing surrounding environment and electronic device for the same An electronic device is provided. The electronic device includes a housing, at least one ultrasonic wave generator and at least one ultrasonic sensor operatively disposed on the housing, and a processor electrically connected to the at least one ultrasonic wave generator and the at least one ultrasonic sensor and configured to emit ultrasonic waves from at least one surface of the housing using the at least one ultrasonic wave generator, receive reflected waves reflected from at least one object through the at least one ultrasonic sensor, and determine a proximity between the electronic device and the object based on at least a difference between a first time, at which the ultrasonic waves are emitted, and a second time, at which the reflected waves are received.
US09897694B2	Ultrasound imaging probe An elongate probe (204) including a probe head (214) with a transducer array (216), a shaft (210) and an articulating member (212). The articulating member is located between the probe head and the shaft. The articulating member is configured to articulate between a position in which the probe head extends along a longitudinal axis of the probe and at least one articulated position in which the probe head extends at a non-zero angle from the longitudinal axis of the probe. The probe further includes a stiffener (224) configured to controllably move from a retracted position to an extended position at which the stiffener inhibits articulation of the articulating member.
US09897693B2	Method and apparatus using light amount values and determined weight value for controlling gesture sensor An electronic device and a method for controlling a gesture sensor of the same are provided. The electronic device includes a gesture sensor and a threshold determining module configured to receive a light amount measurement with respect to light incident to the gesture sensor, to compare the light amount measurement with a light amount reference value, and to determine a light amount threshold that is used based on object recognition of the gesture sensor by adding the weight value to the light amount measurement.
US09897690B2	Technique for a pulse/phase based laser rangefinder utilizing a single photodiode in conjunction with separate pulse and phase receiver circuits A technique for a pulse/phase based laser rangefinding instrument utilizing a single photodiode in conjunction with separate pulse and phase receiver circuits. The photodiode receives phase and pulse ranging signals and a capacitor coupled to the photodiode and is operative to provide current through the photodiode to a transimpedance amplifier in a pulse mode of operation and from the photodiode through a tuned circuit to a narrow band amplifier in a phase mode of operation.
US09897684B2	Systems and methods for estimating a position of a receiver in a network of beacons Systems and methods for estimating a position of a receiver within a venue using localized networks of beacons. Certain aspects relate to different configurations of networks. Other aspects relate to estimating the position of the receiver when the receiver approaches an edge of a localized network of beacons.
US09897682B2	Magnetic synchronization for a positioning system A synchronization system for an acoustic signal-based positioning system is provided that generates a magnetic field as a synchronization signal. The magnetic synchronization signal is transmitted by a transmitter of the positioning system and received by the receiver of the positioning system. The receiver may include a magnetic synchronization signal receiver that may receive the magnetic synchronization signal on a same acoustic channel as an acoustic positioning signal. Moreover, the magnetic synchronization signal receiver may be a component already present in the receiver and capable of receiving a magnetic synchronization signal.
US09897660B2	Apparatus and method for estimating parameter of secondary battery Disclosed is an apparatus and method for estimating a parameter of a secondary battery. The apparatus according to the present disclosure includes a sensor means configured to measure a plurality of current-voltage data while a charging current decreases when a secondary battery is charged in such a pattern that the charging current increases to a peak value and then decreases, and a control means configured to receive an input of the plurality of current-voltage data from the sensor means, calculate a linear approximation equation representing a correlation between a current and a voltage from the plurality of current-voltage data, and estimate a Y intercept of the linear approximation equation as an open-circuit voltage of the secondary battery.
US09897654B2	Two signal JTAG wafter testing bist and scan tap domains Testing of die on wafer is achieved by; (1) providing a tester with the capability of externally communicating JTAG test signals using simultaneously bidirectional transceiver circuitry, (2) providing die on wafer with the capability of externally communicating JTAG test signals using simultaneously bidirectional transceiver circuitry, and (3) providing a connectivity mechanism between the bidirectional transceiver circuitry's of the tester and a selected group or all of the die on wafer for communication of the JTAG signals.
US09897653B2	Scan chain circuit supporting logic self test pattern injection during run time A scan chain for testing a combinatorial logic circuit includes a first scan chain path of flip-flops connected to the combinatorial logic circuit for functional mode operation during runtime of the combinatorial logic circuit. A second scan chain path of flip-flops is also connected to the combinatorial logic circuit and supports both a shift mode and a capture mode. The second scan chain path operates in shift mode while the first scan chain path is connected to the combinatorial logic circuit for functional mode operation. The second scan chain is then connected to the combinatorial logic circuit when run time is interrupted and operates in capture mode to apply the test data to the combinatorial logic circuit.
US09897650B2	Integrated circuit and storage device including integrated circuit An integrated circuit including first pads and second pads, a first receiver circuit and a first driver circuit respectively connected to the first pad, a second receiver circuit and a second driver circuit respectively connected to the second pad, and a first loopback circuit having a first input terminal electrically connected to the first receiver circuit, a first output terminal electrically connected to the first driver circuit, a second output terminal electrically connected to the second driver circuit, and a second input terminal electrically connected to the second receiver circuit may be provided. At a normal mode, the first loopback circuit electrically connects the first input terminal to the second output terminal and electrically connects the second input terminal to the first output terminal. At a test mode, the first loopback circuit electrically connects the first input terminal to the first output terminal.
US09897647B2	Method and apparatus to commission voltage sensors and branch circuit current sensors for branch circuit monitoring systems A method and apparatus for detecting the wiring configuration of an electric power system based upon a particular voltage ratio that is determined for the electric power system. Also a method and apparatus for diagnosing voltage swap conditions in an electric power system. Finally, a method and apparatus for identifying virtual meters in an electric power system.
US09897633B2	System and method for switch status detection Systems, methods, and circuits for determining one or more switch statuses are disclosed herein. In one example embodiment, such a system for determining a status of a switch having first and second terminals includes a first port configured to be coupled to the first terminal, a second port configured to be coupled to the second terminal, and a capacitor coupled between the first port and ground. Additionally, the system includes a comparator device having first and second input ports and an output port, the first input port being coupled at least indirectly to the first port, a current source coupled to the first input port, and a voltage source coupled between the second port and the second input port. The comparator device is configured to provide an output signal at the output port that is at least sometimes indicative of the status of the switch.
US09897628B2	Method and apparatus for docking a test head with a peripheral A method and apparatus for docking a test head to a peripheral. A docking pin (150) is moved past a projection (803) in a catch (802). The docking pin is further moved until the catch rotates and the projection in the catch engages a notch or indentation (152, 156) in the docking pin. A piston (620) is moved on to the catch so that the catch is prevented from rotating. The piston is further moved so that the test head is docked to the peripheral.
US09897612B2	Fibronectin type III repeat based protein scaffolds with alternative binding surfaces Protein scaffolds and scaffold libraries based on a fibronectin type III (FN3) repeat with an alternative binding surface design, isolated nucleic acids encoding the protein scaffolds, vectors, host cells, and methods of making thereof are useful in the generation of therapeutic molecules and treatment and diagnosis of diseases and disorders.
US09897608B2	Detection of ovarian cancer using antibody arrays Disclosed are antibody arrays for the detection of cancer in a human or animal subject, comprising a solid support having disposed thereon in a predetermined spatial configuration, a panel of antibodies specific to biomarkers comprising CA-125, MSP-α, TIMP-4, PDGF-Rα and OPG, wherein the panel comprises a first antibody or fragment thereof that specifically binds CA-125, a second antibody or fragment thereof that specifically binds MSP-α, a third antibody or fragment thereof that specifically binds TIMP-4, a fourth antibody or fragment thereof that specifically binds PDGF-Rα, and a fifth antibody or fragment thereof that specifically binds OPG. Also disclosed are systems containing the arrays and methods of using the arrays to detect cancer such as ovarian cancer.
US09897602B2	Microarray substrate, microarray, microfluidic system and methods for preparing the same A microarray substrate including a piece of fluoropolymer whose surface is modified with polydopamine, in which the polydopamine forms an array of microspots on the surface of the fluoropolymer piece, and allows immobilization of molecules or cells. A microarray including the substrate, a microfluidic system designed for dispensing reagents onto selected locations on the surface of substrates, and a method for preparing the substrate and the microarray, in which a dopamine solution is dispensed onto the fluoropolymer piece using the microfluidic system, and forms an array of polydopamine microspots serving as the reaction sites for microarray analysis.
US09897595B2	Compositions and methods for the detection of zinc The invention relates generally to compositions and methods for the detection of zinc. In particular, compositions and methods are provided to detect changes in cellular zinc concentration and to correlate them to cellular phenomena.
US09897588B2	Method for analyzing body fluids A test instrument for analyzing body fluids such as blood or urine. The instrument includes a wound test tape which can be transported from a storage space into a waste space by advancing the tap. The test tape has a plurality of test sections to which body fluid can be applied at a receiving position and also includes a measuring unit for detecting a constituent of the body fluid on an active test section. In order to carry out auxiliary instrument functions, in addition to the test sections, the test tape has one or more functional sections which can be brought into a functional position by advancing the tape.
US09897578B2	Chromatography columns A chromatography column (2) containing a bed of packed particles (22, 24, 26, 28, 30), wherein the packed particles comprise fused core particles and the particle diameters of the packed particles vary along the column. Preferably, the particles (2, 24, 26, 28, 30) are arranged according to their average particle diameter, in order of increasing average particle diameter from the inlet end (4) to the outlet end (6). The bed may comprise a plurality of bed sections and each bed section has an average particle diameter calculated from the particles in that section and there are at least two different average particle diameter bed sections, wherein the particles of each bed are separated from particles of an adjacent bed by a partition that is liquid permeable to allow through a flow of mobile phase. A high column efficiency can be provided with lower pressure drop per unit length of the column.
US09897573B2	System, method and computer-accessible medium for providing generalized local maxwell tomography for mapping of electrical property gradients and tensors Exemplary system, method, and computer-accessible medium can be provided for determining at least one property (e.g., an electrical property or a cross-section property) of at least one target. For example, it is possible to determine electromagnetic-field-related quantities associated with signals provided from the target(s). The electromagnetic-field-related quantities can be provided to procedures to relate the electromagnetic-field-related quantities to a plurality of unknown electrical property values and residual field-related unknown values of the target(s). The property(ies) of the target(s) can be determined by determining the plurality of unknown electrical property values and residual field-related unknown values of the target(s).
US09897561B2	Method of detecting defects in an object based on active thermography and a system thereof There is provided a method of detecting defects in an object based on active thermography, the method including heating a surface of the object at a plurality of localized regions thereof, selecting at least one of the localized regions as a reference region, selecting at least another one of the localized regions as a comparison region, comparing a thermal response at the comparison region to a thermal response at the reference region due to the heating, and determining whether the object has a defect based on the comparison. There is also provided a corresponding system for detecting defects in an object.
US09897559B2	Method for collecting accurate X-ray diffraction data with a scanning two-dimensional detector An X-ray diffraction system uses a two-dimensional detector to detect diffracted X-ray energy at a plurality of radial positions surrounding a sample location, the results at each position being combined to form a final diffraction image. To minimize smearing in the final image, the detector pixel intensities at each position are reapportioned among the pixel locations prior to being combined with the intensities collected at other positions. A two-dimensional pixel array space of the detector is projected onto a cylinder to form a projected pixel array space, and a virtual cylindrical detection surface representative of an ideal cylindrical detector is determined. An overlap between the pixels of the projected pixel array space and the pixels of the virtual cylindrical detection surface is determined, and pixel intensities are reapportioned accordingly. The reapportionment may include dividing each pixel space into subpixels and redistributing the subpixels among adjacent pixels.
US09897540B2	Apparatus and method for inspecting material of an object A material inspection apparatus includes a light source, a light receiver, a light converter, and a processing unit. The light source is configured to emit light to a surface of an object to be inspected. The light receiver is configured to receive light reflected from the surface of the object. The light converter is configured to convert the light received by the light receiver into an electric current. The processing unit is configured to determine, according to the electric current, a material of the surface of the object.
US09897538B2	Method and apparatus for improving image clarity and sensitivity in optical coherence tomography using dynamic feedback to control focal properties and coherence gating Methods for optical imaging, particularly with optical coherence tomography, using a low coherence light beam reflected from a sample surface and compared to a reference light beam, wherein real time dynamic optical feedback is used to detect the surface position of a tissue sample with respect to a reference point and the necessary delay scan range. The delay is provided by a tilting/rotating mirror actuated by a voltage adjustable galvanometer. An imaging probe apparatus for implementing the method is provided. The probe initially scans along one line until it finds the tissue surface, identifiable as a sharp transition from no signal to a stronger signal. The next time the probe scans the next line it adjusts the waveform depending on the previous scan. An algorithm is disclosed for determining the optimal scan range.
US09897535B2	Optical reader systems and methods for microplate position detection Optical reader systems and methods with accurate microplate position detection capability are disclosed. The optical reader systems having scanning optical systems that are configured to scan select position-detecting features on the microplate to accurately determine their respective positions. The measurement of the positions of the position-detecting features can also be used to calibrate the optical reader system to reduce or eliminate adverse positioning effects from system non-linearities that arise from one or more of the system components, including the scanning optical system.
US09897533B2	Structural health monitoring sensory arrangement integrated within a self-healing system An integrated system and method to acquire the health state of a structure identifying the presence of damage, and to self-repair the damage in the considered structure. A sensor network installed in the structure is interrogated by a dedicated hardware for damage detection. In case of damage is detected by the sensor network in the structure, the sensor network is triggered and generates harmonic excitation in the structure. Due to the excitation, the natural frequency of vascular microtubes and/or capsules presented in the structure is reached, promoting their disruption. The vascular microtubes and/or capsules disruption along the damage releases the healing compound, repairing the damaged portion of the structure.
US09897530B2	Compensation of motion-related error in a stream of moving micro-entities Apparatus and methods for detecting, characterizing, and compensating motion-related error of moving micro-entities are described. Motion-related error may occur in streams of moving micro-entities, and may represent a deviation in and expected arrival time or an uncertainty in position of a micro-entity within the stream. Motion-related error of micro-entities is observed in a flow cytometer, e.g., as pulse jitter, and is found to have a functional dependence on a parameter of the system. The pulse jitter can be compensated, according to one embodiment, by adjusting data acquisition observation windows. For the flow cytometer, a reduction of pulse jitter can improve measurement accuracy, resolution of doublets, system throughput, and enable an increase in an interrogation region for probing the micro-entities.
US09897523B2	Contact mechanic tests using stylus alignment to probe material properties An apparatus for performing a contact mechanics test on a substrate includes a stylus, a core configured to engage the stylus against the substrate, a stylus engagement mechanism configured to induce a contact load or a penetration depth to the stylus, a core engagement mechanism configured to maintain contact of the core and to move the core along the substrate surface, a frame configured to be fixed with respect to the apparatus or to be moved together with the core engagement mechanism as an assembly, a frame engagement mechanism configured to engage the frame with the substrate surface; and a substrate monitoring device configured to measure characteristics of substrate contact response and/or collect material machined from the substrate. Methods of performing a contact mechanics test are also provided.
US09897522B2	Method for determining mechanical properties of a material A tool having at least one vibration sensor and at least one standoff is disposed in a contact with a material and the at least one standoff of the tool is pushed into the material. Vibration is excited by the at least one vibration source and at least one coupling frequency of the tool is measured by the at least one vibration sensor. Based on the determined coupling frequency determining a contact stiffness of the at least one standoff and the mechanical properties of the material are determined taking into account mechanical properties of the at least one standoff.
US09897517B2	Method for monitoring a thrust fault of an aircraft turbofan A method for monitoring a thrust fault of a turbofan during a modification of the thrust setting of the turbofan, the method including a step of processing the thrust setting via a filtering function and a transient-phase model such as to obtain a modelled thrust, a step of comparing the modelled thrust to the actual thrust such as to determine a thrust difference, a step of comparing the thrust difference to an alarm threshold; and a step of emitting an alarm in the event of exceeding the alarm threshold, wherein at a given iteration, in which the prior modelled thrust is known, the transient-phase model provides a time constant in accordance with the prior modelled thrust, and the filtering function provides a modelled thrust in accordance with the time constant obtained, the prior modelled thrust and the thrust setting.
US09897515B2	Optical fiber fault locator A device includes a processor, a light emitter coupled to the processor, and a memory. The light emitter is configured to generate a first light to be provided to an optical fiber at a first time when a portion of the optical fiber has a first physical configuration and to generate a second light to be provided to the optical fiber at a second time when the portion of the optical fiber has a second physical configuration. The memory stores instructions executable by the processor to determine a first estimated distance associated with a first location of the optical fiber based on the first light, determine a second estimated distance associated with a second location of the optical fiber based on the second light, determine a third estimated distance associated with a third location of the optical fiber based on the first estimated distance and the second estimated distance.
US09897499B2	Planet gear train based torque detector A planet gear train based torque detector is provided with idler gears between an input shaft and an output shaft wherein a rotation of the input shaft rotates the idler gears which rotate the output shaft, and a force is applied to a tangent line between each idler gear and the input shaft; peripheral resilient members, each having a fixed first end and a second end for receiving force applied thereon by the revolution of idler gears; and at least one strain gauge, each attached on one resilient member for measuring a deformation at the resilient member due to the revolution of the idler gears. A torque between the input shaft and the output shaft is obtained by calculating the deformation. The resilient members parallel the input shaft.
US09897493B2	Method for temperature data acquisition A method for determining temperature information for a plurality of tubes in a furnace where one or more digital images provide temperature information for imaged tubes, and temperature information for non-imaged tubes is determined from the temperature information for the imaged tubes and measured temperatures of combined effluent from the imaged and non-imaged tubes.
US09897491B2	Protecting tube deterioration detecting apparatus and method therefor A protecting tube deterioration detecting apparatus applies a predetermined electric current to a measurement target thermocouple with protecting tube for a predetermined time, calculates a temperature rise amount of the thermocouple, and determines, when the calculated temperature rise amount exceeds a predetermined threshold, that the protecting tube is deteriorated.
US09897486B2	Method of calibrating and using a measuring apparatus that performs measurements using a spectrum of light A method of calibrating a measuring apparatus includes determining apparatus parameters that have an influence on a measurement spectrum generated by the measuring apparatus, generating the measurement spectrum by exposing a measurement target on a sample to light generated by the measuring apparatus, calculating an error of the apparatus parameters by comparing the measurement spectrum to an ideal spectrum corresponding to the apparatus parameters, and calibrating the measuring apparatus based on the calculated error of the apparatus parameters.
US09897480B2	Apparatus and method for processing ultrasonic data An apparatus for processing data including a data compressor configured to compress ultrasonic data, and store the compressed ultrasonic data in a memory; and a data decompressor configured to read the stored ultrasonic data from the memory, decompress the read ultrasonic data, and transfer the decompressed ultrasonic data to a processor configured to perform beamforming.
US09897474B2	Apparatus and method for monitoring fuel oil delivery The apparatus for monitoring the delivery of fuel oil through a fuel oil delivery pipe including a flow meter and temperature sensor associated with the oil delivery pipe for measuring the temperature and flow rate of the fuel oil as it moves through the pipe. The digital output signals from the flow meter/temperature sensor are used to generate data signals which are a function of the measured temperature and flow rate parameters. A memory records the data signals. The actual total quantity of fuel oil delivered through the pipe is calculated based upon the data signals. A clock circuit generates a timing signal reflecting the date and time the measurements were taken. A transmission signal formed of the calculated actual total quantity of fuel oil delivered and time signal may be sent to a remote location by a WiFi transmitter or through the internet using a modem.
US09897473B2	Measuring transducer of vibration-type The measuring transducer comprises four measuring tubes (181, 182, 183, 184) as well as two oscillation exciters and (51, 52). The oscillation exciter (51) includes a coil (511) secured to the measuring tube (181) as well as a permanent magnet (512) secured to the measuring tube (182) and movable relative to the coil (511) and the oscillation exciter (52) includes a coil (521) secured to the measuring tube (183) as well as a permanent magnet (522) secured to the measuring tube (184) and movable relative to the coil (521). In the case of the measuring transducer of the invention, the coils (511, 521) are connected electrically in parallel with one another.
US09897470B2	Device for characterizing a physical phenomenon by ablation of an optical fiber with bragg gratings having a total flux of reflected radiation measurement A device for characterizing a physical phenomenon that includes at least one optical fiber with short Bragg gratings having constant spacing, at least one broad spectrum laser lighting source, an optical circulator and a photoelectric detector that is configured to measure a global flux of all the reflected radiation picked up at the output of the optical circulator, as a function of time. Further disclosed is a method of characterization in which the global flux of the signal is measured in such a way that a drop in the signal corresponds to the destruction of a Bragg grating.
US09897454B2	Host-vehicle-travel-position specification apparatus and host-vehicle-travel-position specification program product The host-vehicle-travel-position specification apparatus specifies an estimation error range of map matching reference positions based on relation between a map-matching reference trajectory and an estimation error range of estimated absolute positions. The map-matching reference trajectory is corrected to accord with the estimation error range of map matching reference positions. A vehicle travel position is specified based on the corrected map-matching reference trajectory.
US09897447B2	Quadrature compensation A microelectromechanical sensor device that comprises a seismic mass, and a spring structure that defines for the seismic mass a drive direction, and a sense direction that is perpendicular to the drive direction. A capacitive transducer structure includes a stator to be anchored to a static support structure, and a rotor mechanically connected to the seismic mass. The capacitive transducer structure is arranged into a slanted orientation where a non-zero angle is formed between the drive direction and a tangent of the stator surface. The slated capacitive transducer structure creates an electrostatic force to decrease quadrature error of the linear oscillation.
US09897436B2	Measuring instrument and surveying system The invention provides a measuring instrument, which comprises an image pickup unit for acquiring an image of a range including an object to be measured, a distance measuring unit for two-dimensionally scanning a predetermined range in synchronization with an image acquisition and for measuring, an arithmetic control unit and an attitude detecting unit for detecting a tilt angle of the image pickup unit with respect to a horizontality, wherein the arithmetic control unit associates a measurement result and a detection result of the attitude detecting unit with each pixel on a scanning locus corresponding to an acquired image.
US09897424B2	Shot shells with performance-enhancing absorbers Shot shells with enhanced performance due to inclusion of an absorber between the shot wad and the shot payload. The absorber reduces the pressure within a shot gun's chamber during firing of the shell, such as by absorbing energy generated during the firing process, and may thereafter return some of the energy to the pellets as the absorber and pellets are propelled along the firearm's barrel. Accordingly, the absorber enables a shot shell to generate shot payload velocities that are greater than would be achieved without the absorber, typically at a lower internal chamber pressure. In some embodiments, the absorber has (1) a Young's Modulus of less than 2,000 psi (137.9 bar), (2) a compressive strength of at least 100 psi (6.9 bar) and/or less than 10,000 psi (689.5 bar), and/or (3) a tensile strength of at least 145 psi (10 bar) and/or less than 10,000 psi (689.5 bar).
US09897423B2	Color changing lighted nock for arrow shafts An LED of a lighted nock sequentially advances through multiple different emitted colors by exposing the nock to a magnetic field. The nock is placed in the activated or lit state. Then a magnet is brought within range of a magnetic sensor included in the electronic circuit of the nock assembly. The change in the magnetic field causes the electronic circuit to advance the emitted LED light to the next color in a sequence of multiple colors. Repeated removal and re-application of the magnetic field while the LED remains lit advances the LED color repeatedly through the available colors until the user reaches their desired color. Then the LED is deactivated or turned off. Then when the LED is re-lit, it will still be in the last color chosen, and will remain there until the color is advanced again.
US09897422B1	Fireworks aerial display shell with multiple breaks and a method involving same A fireworks aerial display shell is provided with multiple casings of cylindrical configuration that are joined together in end-to-end relationship. Each casing defines an interior volume in which an effects charge is packed. A plug is positioned between the effects charges and has an opening through which an ignition source passes to ignite one of the effects charges as a result of burning of another of the effects charges. An outer casing may surround at least parts of the multiple cylindrical casings and includes multiple partially ball-shaped segments.
US09897417B2	Payload delivery Disclosed is a method for delivering a load on-board an aircraft to a target. The method comprises: acquiring a position of the target; acquiring parameter values relating to aircraft maneuverability; acquiring load properties; acquiring parameter values relating to environmental conditions; using the acquired information, determining a position and a velocity value; performing, by the aircraft, the procedure; and, at a point in the procedure that the aircraft has the determined position and its travelling at a velocity equal to the determined velocity value, releasing the load. The determined position and velocity value are such that, were the aircraft to release the load while having the determined position and velocity, the load would travel to be within a predetermined distance of the target. The procedure is such that the aircraft would have the determined position and velocity at some time-step.
US09897409B2	Flow dividing valve structure for toy gun A flow dividing valve structure for a toy gun includes: a propulsion portion; a rotating auxiliary portion extended from one face of the propulsion portion; and a latching portion, configured on one end of the rotating auxiliary portion far away from the propulsion portion, where the rotating auxiliary portion is configured with a plurality of wing portions each twisted toward a direction away from the propulsion portion so as to be allowed to have at least one twisted face. Whereby, high pressure gas will drive the rotating auxiliary portion to rotate through the wing portions when flowing through the rotating auxiliary portion, and further remove the frost generated inside a gas chamber so as to prevent the unsmooth operation of the flow dividing valve.
US09897407B2	Firearm-mounted camera device with networked control and administration system and method An electronic camera device, and associated system and interfaces, that generates, records and transmits video, audio and sensor data. Camera device comprises a housing with a fastening mechanism adapted to mount the device to a firearm. The device has a processor module, a memory module for storage, a camera module configured to generate and record video and store the video to memory. The device further includes a magnetic sensor configured to detect the presence and absence of a magnet and an accelerometer that is configured to detect a draw motion (e.g., a firearm being unholstered). When the magnetic sensor detects the absence of a magnet, and the accelerometer detects a draw motion, one or more corresponding signals are generated and transmitted, directing the camera to begin recording (and transmitting) video and send an alert signal to assets in the field to provide support.
US09897406B2	Upgrade kit for assault rifle An upgrade kit for an assault rifle, the rifle comprising a rear trunnion and a barrel, the kit comprising a mounting rail assembly adapted to provide steady and tight attachment to the barrel, an ambidextrous charging handle assembly adapted to be installed on the right or the left side of the rifle, at substantially the same location along the longitudinal axis. The charging handle assembly comprises a modified bolt carrier having a perforation, an installation rod having a first gap, and the installation rod corresponding in shape to the perforation in the bolt carrier. The charging handle is configured to be gripped by a user, and an intermediate section having a second gap, and connected to the installation rod and to the charging handle.
US09897405B2	Mini-gun with access door A delinking feeder of a minigun includes an access door mounted to a delinking feeder housing and movable between a closed position and an open position. The access door has an enclosed recess for receiving a tongue that is rotationally coupled to the access door and is movable between a retracted position and a deployed position. When the access door is in the open position, the tongue is in the deployed position and a tongue first contact surface can contact and secure a linked cartridge positioned in the delinking feeder. When the access door is in the closed position, the tongue is in the retracted position and a tongue second contact surface can contact and guide a cartridge positioned in the delinking feeder. The enclosed recess is covered so that when the access door is in the closed position, the tongue does not protrude through the access door.
US09897395B2	Tank for heat exchanger, and method for manufacturing the same A tank includes a tank wall that has an opening, which is configured into a generally rectangular form that extends in a longitudinal direction and a lateral direction while a cross section of the tank wall, which is perpendicular to the longitudinal direction of the opening, is curved, and a tank foot is formed to extend all around the opening of the tank wall. A gate position is placed in a longitudinal center portion of one side surface of the tank foot, which extends in the longitudinal direction of the tank wall.
US09897390B2	Fixing structure for heat dissipation element A fixing structure for heat dissipation element includes a base plate, a heat transfer element, and at least one fixing member. The base plate has a top surface, on which a receiving recess is defined for receiving the heat transfer element therein. At least one clearance is defined between the receiving recess and the heat transfer element. The fixing member has a fixing portion and an extended portion. The fixing portion is connected to the top surface of the base plate, whereas the extended portion is bent and inserted into the clearance to locate between the receiving recess and the heat transfer element, such that the heat transfer element is firmly held in the receiving recess of the base plate.
US09897388B2	Composite exhaust gas recirculation cooler A cooler having a first component made of at least one of steel, stainless steel, plastic and ceramic. A second component may be made of aluminum, wherein the two components may be connected to each other in a connecting area via a friction stir weld joint.
US09897385B2	Helical coil heating apparatus and method of operation A heating apparatus comprises an exposed tube formed into an outer coil and an inner coil. The outer coil is formed around the inner coil with a gap separating the outer coil and the inner coil. The tube is supported by a support frame. The heating apparatus also comprises a spacer frame that extends from the top portion of the support frame to the base portion of the support frame. The spacer frame has a plurality of apertures formed therein, each aperture operable to support a corresponding ring of the outer coil. The apparatus also comprises a spacer rod having a first end that couples to the top portion of the support frame and a second end that couples to the base portion of the support frame, wherein the spacer rod is threaded through the spacer frame between the outer coil and the vertex of the spacer frame.
US09897384B2	Heat exchanger, especially for a motor vehicle, and corresponding air intake device A heat exchanger for heat exchange between at least two fluids, especially for a motor vehicle, comprises a bundle (7) for heat exchange between said fluids, and a housing (9) for receiving said bundle (7), said housing (9) having at least one raised edge (11). The heat exchanger also has a seal (15) of a rigid plastic material, said seal enveloping said at least one raised edge (11) and being designed to ensure the tightness between the exchanger and a container of said exchanger. The heat exchanger can also be included in an air intake device including such a heat exchanger and an air intake collector.
US09897381B2	Supporting structure and oven A supporting structure for supporting a substrate in an oven is disclosed. The oven is for baking the substrate in a production process of liquid crystal panel. The supporting structure includes: a fixing frame including a frame body, and a fixing portion and a support portion fixed to the frame body, wherein the fixing portion provides with a sliding slot, the fixing portion is provided with at least one positioning region located inside the sliding slot, through a fastener passing through the positioning region, the fixing portion is secured and fixed to a heating platform of the oven such that the frame body is fixed to the heating platform; a supporting strip engaged at the support portion; and multiple supporting pins disposed separately on the supporting strip to support the substrate. The supporting structure can move positions of the supporting pins. An oven applying the supporting structure is also disclosed.
US09897380B2	Carrier transport system A carrier transport system transports a plurality of carriers by a transport conveyor into a heating furnace, advances a comb-shaped carrier stopper having a plurality of protrusions toward the carriers, moves the carriers by the transport conveyor in a transport direction to engage cutout grooves, provided respectively for the carriers, with the protrusions of the carrier stopper to thereby position the carriers at a time. The carrier transport system advances the carrier stopper toward the carriers to insert distal ends of the protrusions of the carrier stopper into insertion holes, and then determines, on the basis of a moved distance X of the carrier stopper, whether the carriers are properly positioned.
US09897379B2	Shaft furnace charging device equipped with a cooling system and annular swivel joint therefore A shaft furnace charging device and cooling system includes a suspension rotor with a charge distributor and stationary housing. The cooling system includes an annular swivel joint arranged coaxially on an axis, connecting stationary and rotary circuit portions. The swivel joint includes forward connections for receiving cooling fluid from the stationary circuit portion and supplying cooling fluid to the rotary circuit portion; return connections for receiving cooling fluid from the rotary circuit portion; and returning cooling fluid to the stationary circuit portion. The swivel joint includes a partition dividing the annular volume into cavities wherein an internal cavity is partially surrounded by an external cavity, and the forward connections are coupled via one of the cavities and the return connections are coupled via the other of the cavities. The swivel joint includes leakage-permitting communication between the external and internal cavities through annular clearances. Annular flow restrictors are provided in clearances.
US09897374B2	Cold water tank There is provided a cold water tank including: a first tank having an inlet pipe through which water to be cooled is introduced; and a second tank provided in the interior of the first tank such that water of the first tank can be introduced thereinto, having an evaporator included in a refrigerating cycle to cool the introduced water, and having an outlet pipe through which cooled water flows. Although water is introduced at high pressure, the introduced water can remain in the cold water tank for a period of time required for being cooled, and although water is introduced at high pressure, the introduced water can be in a stable state in the cold water tank. Thus, water can be cooled with its inflow pressure maintained, and the degree of freedom of a faucet or cock for allowing cold water to flow therethrough can be improved in its height.
US09897367B2	Freezing detection device A freezing detection device to be applied to a liquid cooling apparatus including a liquid tank for storing a liquid whose freezing is to be detected and a cooling unit located inside the liquid tank to cool the liquid, the freezing detection device comprises: a temperature detecting unit located at a predetermined distance from the cooling unit; and a determining unit configured to determine whether or not the liquid has frozen around the temperature detecting unit based on an output from the temperature detecting unit, the determining unit determining whether or not the liquid has frozen around the temperature detecting unit based on whether the output from the temperature detecting unit is fluctuating or not.
US09897364B2	High efficiency refrigerator A thermal storage container is coupled to a pump for circulating cooled liquid from the thermal storage container in at least one of two circuits. One circuit includes a heat exchanger coupled to the fresh food evaporator for assisting in cooling the fresh food section of the refrigerator or for chilling the liquid. Another circuit includes a sub-cooler between the condenser and the evaporator for cooling the output from the condenser before entering the evaporator, herby increasing the efficiency of the system. A three-way valve is coupled from the output pump to couple the stored coolant selectively to one or the other or both of the coolant circuits.
US09897357B2	Isentropic expansion device Systems and methods may include a heating, ventilation, and air conditioning (HVAC) system having a heat exchanger and an expansion device disposed upstream and in fluid communication with the heat exchanger. The expansion device includes a pressure recovery portion. The expansion device may also include an isentropic expansion device and/or a substantially isentropic expansion device.
US09897343B2	Water heating apparatus A water heating apparatus, including: a heat source circuit including a first circulation pump, a heat pump, and a heat source side of a hot water supply tank heat exchanger that are connected to each other by a pipe, the heat source circuit being configured to allow water to circulate therethrough; a hot water supply circuit including a second circulation pump, a use side of the hot water supply tank-use heat exchanger, and a hot water supply tank that are connected to each other by a pipe, the hot water supply circuit being configured to allow water to circulate therethrough; and a control unit configured to perform, when the hot water supply tank temperature falls below the reheating tank temperature, reheating, and control a flow rate of the second circulation pump.
US09897338B2	Coordinated air-side control of HVAC system A method and apparatus for controlling an HVAC system. The method may include receiving a fan speed signal from a fan control loop, and choosing among an independent mode, a first linked mode, and a second linked mode, depending on the fan speed signal. The method may also include providing a signal to a pressure control loop to reduce a speed of a supply air fan of an AHU, when the first linked mode is chosen. The method may further include providing a signal to a temperature control loop to decrease a speed of a heat exchange wheel, to decrease a flow rate of a heat exchange fluid to an evaporator coil, or both, when the second linked mode is chosen. The method may additionally include allowing the fan control loop to operate independently of the temperature and pressure control loops, when the independent mode is chosen.
US09897324B2	Combination EMI shield and mounting system for electronic controlled gas cooking An electromagnetic interference (EMI) shield for gas cooktops is disclosed herein. The EMI shield protects electromagnetic fields output by a high voltage spark ignition system from interfering with sensitive low voltage controls for the cooktop. Accordingly, the low voltage controls and similar elements are mounted on one side of the EMI shield and the high voltage spark ignition system, burners, and similar elements are mounted on another side of the EMI shield. In order to connect elements on each side of the EMI shield as may be necessary (e.g., electrical wires and gas tubing), the EMI shield can have a plurality of small openings. The EMI shield may also provide a mount for controls and/or a user interface for displaying information and controlling the cooktop.
US09897322B2	Combustor assembly for a gas turbine engine and method of making same A combustor can assembly includes a plurality of combustor cans spaced circumferentially about a gas turbine engine. Each combustor can is coupled in flow communication with at least one fuel manifold via a respective can fuel line. The combustor can assembly also includes a first interconnecting fuel line that includes a first end and a second end. The first end is coupled in flow communication with the can fuel line of a first combustor can, and the second end is coupled in flow communication with the can fuel line of a second combustor can that is not circumferentially adjacent to the first combustor can. The combustor can assembly further includes a first control device operatively coupled to the can fuel line of the first combustor can. The first control device is operable to change a dynamic operational characteristic of the first and second combustor cans independently of other combustor cans.
US09897321B2	Fuel nozzles A nozzle includes a nozzle body defining a longitudinal axis. The nozzle body includes an air passage having a radial swirler and a converging conical cross-section. A fuel circuit is radially outboard from the air passage with respect to the longitudinal axis. The fuel circuit extends from a fuel circuit inlet to a fuel circuit annular outlet. The fuel circuit includes a plurality of helical passages to mitigate gravitational effects at low fuel flow rates. Each helical passage of the fuel circuit opens tangentially with respect to the fuel circuit annular outlet into an outlet of the air passage.
US09897319B2	Igniter position for a combustor of a gas turbine engine The present disclosure relates combustor configurations for a gas turbine engine. In one embodiment, a combustor includes a combustor shell enclosing a first area of free space, and an igniter for the combustor shell, the igniter including a distal end. The combustor also includes one or more elements configured to retain the igniter and to interface with the combustor shell, wherein the igniter is retained that the distal end of the igniter is recessed from the first area of free space. According to another embodiment, a combustor configuration may include one or more elements configured to retain an igniter and interface with the combustor shell, wherein the one or more elements define a boundary between the combustor shell and one or more elements, and wherein the igniter is retained within the one or more elements such that the distal end of the igniter is recessed from the boundary.
US09897318B2	Method for diverting flow around an obstruction in an internal cooling circuit A rotary machine including: a casing providing an annular chamber for rotating components of the machine; a cooling passage extending through the casing or mounted to a surface of casing; a plug assembly connected to the cooling passage and in the casing or mounted to the casing, wherein the plug assembly includes a collar and a conduit aligned with an axis of the collar, and the collar includes a cooling air by-pass passage in fluid communication with the cooling passage such that cooling air from the cooling passage flows through the by-pass passage and returns to the cooling passage, and another cooling passage or a port extending through the conduit of the plug assembly.
US09897315B2	Safety device against combustible gas leaks for household appliances A safety device against gas leaks for an apparatus having at least one gas tap or the like (1) includes control means (11), safety means (22) and detection means (12, 53), for detecting possible presence of gas in a surrounding environment. The detection means (12, 53) are in signal communication with the control means (11), which are configured for controlling the safety means (22) in function of detections earned out by the detection means (12, 53), in order to prevent or interrupt the inflow of combustible gas to a burner. The control means (11) and the safety means (22) belong to a first functional unit (A) of the device (A, B), which is coupled or configured for the coupling with a portion of the body (2) of the tap (1). Preferably the safety means (22) are controllable by the control means (11) for interrupting electric power supply to a solenoid of the tap, following a command signal generated by the detection means (12, 53) and causing as a consequence the passage of the valve in the respective closed condition.
US09897313B2	Water-based system and method of collecting and transporting exhaust gas A system and method of collecting and transporting exhaust gases, preferably gases generated via the burning of fossil fuels, to a remote treatment facility. The exhaust gases include greenhouse gases, airborne particulates, and other pollutants. The present system comprises a gas extraction cap for collecting exhaust gas emitted from a point source of pollution, a pump for drawing water from a water source, a means for mixing the captured exhaust gas with the drawn water, a pipeline for transporting the gas-water solution to a remote treatment facility, and one or more high-pressure boilers for separating the water from the gas-water solution, leaving the exhaust gases available for treatment at the facility. Once the gas-water mixture arrives at the processing location, it then goes through one or more boiling steps in order to separate the water from the captured gases.
US09897312B2	All around radiation heating apparatus The present invention provides a safer all-around radiation heating assembly than similar traditional heaters. As typical with traditional heaters, a shroud is used to surroundably cover a portable liquid propane tank. To replace the portable liquid propane tank, the shroud must be continuously raised to a predetermined height while a service person accesses the propane tank. There is a danger that if and when the shroud drops, a spark could be created resulting in igniting highly flammable escaped propane gas. The present invention overcomes dangers associated with the traditional heaters by eliminating the spark creation danger and by introducing a ventilation system to allow any leaked propane gas to escape away from the heater.
US09897308B2	Steam generator with tube aligning orifice A heat transfer system includes a plenum configured to provide a secondary side fluid such as feedwater to a plurality of heat transfer tubes from a primary side fluid, and a tube sheet coupled to the plurality of heat transfer tubes. An orifice plate is mounted within the plenum and located adjacent to the tube sheet, and one or more orifice devices are supported by the orifice plate and are configured for insertion into or sealing against the plurality of heat transfer tubes. The one or more orifice devices may include center flow orifices, and/or rectangular or helical shaped transition stepped annular flow orifices, and an insertion of a number of the transition steps into the plurality of heat transfer tubes may determine a corresponding pressure drop of the secondary side fluid in the heat transfer system.
US09897304B2	LED light re-direction accessory Apparatus and associated methods relate to development of a LED system with high thermal dissipation power relative to the system weight by the inclusion of open regions. The open regions reduce the weight of the optical system while improving airflow. Associated optics are described to efficiently and evenly distribute the light from an LED by tailoring the optical distribution. In addition, circuitry and methods are described to allow for the LED system to operate with existing power sources such as ballast or offline AC voltage sources or both.
US09897303B2	Wavelength conversion device, light source system and projection system The present disclosure provides a wavelength conversion device, and its light source system and projection system. The wavelength conversion device includes a wavelength conversion material layer, and a first light-filtering layer on a first side of the wavelength conversion material layer. The wavelength conversion device also includes a first thermally-conductive dielectric layer configured between the wavelength conversion material layer and the first light-filtering layer. The first thermally-conductive dielectric layer has a thermal conductivity greater than or equal to the wavelength conversion material layer, and has a refractivity less than the wavelength conversion material layer. Accordingly, the heat generated by the wavelength conversion material layer may be timely conducted out, thus improving the conversion efficiency of the wavelength conversion device.
US09897297B2	Moving light with follow spot A luminaire that has multiple removable handles thereon, and can operate in multiple different modes, including a mode where a manual follow spot can occur. To operate in the manual follow spot mode, the luminaire is placed into a free moving mode in which it can be moved, and then the luminaire is moved using the removable handles to manually place the luminaire in a desired location. Then, the luminaire is commanded to remain in that desired location by turning on breaks or the like. In the manual movement mode, movement of the luminaire is manually controlled and not remotely controlled and all of at least color, gobo, beam size and other parameters are remotely controlled.
US09897289B2	Light fixture with photosensor-activated adjustable louver assembly and color temperature control A light fixture includes a housing with a skylight aperture, and one or more louver blades spanning the skylight aperture. When open, the one or more movable louver blades block little of the light passing through the skylight aperture; in intermediate positions, the louver blades block a portion of the light; when closed, the louver blades block most light from passing through the skylight aperture. The light fixture also includes: a dimmable artificial light source configured to project artificial light toward the illuminated space; a light sensor that detects light illuminating the space; and a control unit that is integrated with the housing and communicates with the light sensor. The light sensor detects intensity and chromaticity information of the light illuminating the space. The control unit controls position of the louver blades and brightness and chromaticity of the dimmable artificial light source, in response to the light sensor.
US09897286B2	Phosphor optical element and light-emitting device using the same A phosphor optical element includes: a base member; a phosphor-containing member that includes a transparent member containing a phosphor particle; and a cover member, wherein the base member, the phosphor-containing member, and the cover member are sequentially formed on a transparent base that is transparent to a wavelength of incident light from an excitation light source, the phosphor particle has a diameter no greater than the wavelength of the incident light, and in an arbitrary cross section of the phosphor-containing member in a direction perpendicular to a main surface of the transparent base, the phosphor-containing member has, in a direction perpendicular to the main surface of the transparent base, a thickness no greater than the wavelength of the incident light.
US09897283B2	Generating a light emission pattern by illuminating a phosphor surface A method for generating a light emission pattern by illuminating at least one phosphor surface by at least one primary light beam is provided. The method includes: directing the primary light beam only onto a partial surface of the entire illuminatable phosphor surface; and illuminating at least one partial region of said partial surface more intensely than in the case of uniform illumination of the illuminatable phosphor surface.
US09897281B2	Optical module and light source An optical module and a light source are provided. The light source includes a circuit board, a plurality of light-emitting element chips, a plurality of total reflection elements, an encapsulant, and a plurality of optical wavelength conversion particles. The light-emitting element chips are disposed on the circuit board. Each of the light-emitting element chips is adapted to emit a light beam. The total reflection elements are disposed on the circuit board. Each of the total reflection elements is configured adjacent to one of the light-emitting element chips, a partial light beam of the light beam emitted by the one of the light-emitting element chips enters the total reflection element, and is transmitted in the total reflection element, and emits out from the total reflection element. The encapsulant covers the light-emitting element chips and the total reflection elements. The optical wavelength conversion particles are distributed in the encapsulant.
US09897276B2	Reduced phosphor lighting devices A lighting device comprising a solid-state light source, and a diffuser configured for color mixing of the light from the solid-state light source and spatially separated therefrom, the diffuser comprising at least one phosphor material. Methods of fabricating a lighting device having a reduced total amount of phosphor comprising combining an amount of phosphor with a diffuser structure.
US09897275B1	Bulb including pump A three-way bulb including light emitting diodes is used to achieve a variety of light output colors and/or intensities. In some embodiments, the inputs to a three-way bulb are configured to perform other functions, such as power a motor. In some embodiments, a bulb including light emitting diodes includes a replicable cover and/or a replicable LED. This cover may be configured to project images or support a shade made of a heat sensitive material.
US09897273B2	Light emitting apparatus and vehicle lighting fixture A light emitting apparatus can include: a first connecting part and a second connecting part connected to each other to form a propagation channel therebetween through which laser beam from a laser light source can propagate, and a power supply cable including a pair of terminals provided in a middle thereof and connected to and separated from each other. One of the terminals can be included in the first connecting part and the other thereof can be included in the second connecting part. When the first connecting part and the second connecting part are connected to each other, the terminals can be connected to each other to constitute a supply channel configured to supply drive power to a driving circuit. When the first and second connecting parts are disconnected, the connected terminals can be separated from each other to cut off the supply channel.
US09897271B2	Wall-mounted sun tracking and light guiding apparatus The present invention relates to a flat wall-mounted sun-tracking and light-guiding device with built-in sensors, which comprises a sun-tracking and light-guiding member, a sun-tracking controller, a light concentrator, and a switchable light emitter. The sun-tracking and light-guiding member owns the function of tracking the sun and is coupled to the sun-tracking controller. The light concentrator faces the sun and is used for concentrating the sunlight. In addition, the light concentrator is connected with the sun-tracking and light-guiding member. The light concentrator includes a light-guiding optical fiber, which is used for guiding the concentrated sunlight. Besides, the switchable light emitter is connected with one end of the light-guiding optical fiber. The switchable light emitter can be disposed indoors or on plant chambers for lighting the interior or plants using the sunlight guided by the light-guiding optical fiber.
US09897259B1	Control system in a gas pipeline network to satisfy pressure constraints Controlling flow of gas in a gas pipeline network, wherein flow within each pipeline segment is associated with a direction (positive or negative). Minimum and maximum signed flow rates are calculated for each pipeline segment constituting lower and upper bounds, respectively, for flow in each pipeline segment. A nonlinear pressure drop relationship is linearized within the lower and upper flow bounds to create a linear pressure drop model for each pipeline segment. A network flow solution is calculated, using the linear pressure drop model, and includes flow rates for each pipeline segment to satisfy demand constraints and pressures for each of a plurality of network nodes to satisfy pressure constraints. Lower and upper bounds on the pressure constraint comprise a minimum delivery pressure and a maximum operating pressure, respectively. The network flow solution is associated with control element setpoints used by a controller to control one or more control elements.
US09897256B2	Compressed gas delivery method A method of continuously conveying compressed gas to a plurality of vehicles, where the plurality of vehicles includes at least a first vehicle having a higher tank pressure and a second vehicle having a lower tank pressure that are simultaneously seeking compressed gas from the same delivery conduit. The method includes compressing gas using at least one compressor, conveying the compressed gas from the at least one compressor to a backpressure apparatus, conveying a non-bypass fill portion through the backpressure apparatus, diverting a bypass fill portion through a bypass conduit to at least one distributor, conveying the bypass fill portion through the at least one distributor to at least one of the one or more delivery conduits and subsequently to at least the first vehicle, and conveying the non-bypass fill portion through at least one of the one or more the delivery conduits to at least the second vehicle.
US09897255B2	Pressure vessel with PCM and method of use The present invention provides a metal-lined composite gas storage device comprising a phase-change material coated on the exterior surface of a metallic liner. The presence of the phase-change material on the exterior surface of the metal liner reduces the temperature change within the interior of the metal liner during a gas filling process compared to a similar vessel that does not have a phase-change material coating, thereby allowing a significantly greater amount of gas to be filled at a given pressure.
US09897253B2	Temperature controlled axle cooling system and method A temperature controlled axle cooling system and method is disclosed. Axle hydraulic circuits cool oil circulating through vehicle axles, and sensors monitor axle temperatures. Pumps are activated to circulate the oil through the axle circuits based on the axle temperatures. Each axle circuit can be a separate closed-loop hydraulic system, not sharing fluid with any other vehicle or axle hydraulic systems. All axle cooling system pumps can be activated when any axle temperature exceeds a high threshold. All pumps can be deactivated when all axle temperatures are below a low threshold. Each pump can be activated and deactivated based only on that axle's temperature. The axle cooling system pumps can be driven by motors powered by the main vehicle hydraulic system flow. A valve can be controlled based on axle temperature to allow main vehicle hydraulic system flow. Multiple pumps can be driven by a single motor.
US09897251B2	Universal arm system A universal arm has a proximal end, a distal end, and a middle portion therebetween. The middle portion has a plurality of interconnected ball and socket pieces. A plurality of clamps is selectively fixedly connected to the distal end of the universal arm by a connection that permits the selective rotation of each one of the plurality of clamps by 360° with respect to the distal end of the universal arm.
US09897248B2	Display device A display device includes a display, a base, a flexible circuitry connecting the display to the base, and a support frame assembly disposed between the display and the base. The support frame assembly includes an inner rail connecting to the base, an outer rail connecting to the display, and a first stop member. The outer rail is movably connected to the inner rail so that the outer rail is disposed at a first position or a second position relative to the base. An accommodation space is formed between the outer rail and the inner rail for accommodating the flexible circuitry. The first stop member is disposed between the inner rail and outer rail and extends from the inner rail and away from the accommodation space for restricting the outer rail to move along the inner rail between the first position and the second position.
US09897239B2	Rapid-connect coupler with vent stop A rapid connect coupler can include a housing, a probe configured to translate within the housing, a handle assembly configured to cause the probe to translate within the housing body, a stop assembly configured to selectively arrest the translation of the probe. The stop assembly can include: a pawl configured to occupy both an active position and an inactive position, wherein the inactive position arrests the translation of the probe; a catch fixed to the housing and configured to hold the probe in the inactive position; a lever configured to engage the pawl; a spring fixed to both the housing and the lever and configured to bias the pawl to the inactive position via the lever; and a cam configured to disengage the pawl from the catch and cause the pawl to occupy the active position.
US09897232B2	Motor-driven valve Provided is a motor-driven valve with a simple configuration that is capable of suppressing flow rate loss of fluid and reducing noise caused by the flow of the fluid in the first flowing direction and the second flowing direction, without greatly changing a conventional motor-driving valve. A porous body is fixed to a valve seat member, the porous body being extended at least to be lateral to a valve port and having a cutout part corresponding to a first opening provided at a lateral part of a valve body.
US09897231B2	Needle valve assembly with rotatable cap A system includes a valve having an annular body, a cap positioned circumferentially about the annular body, and a stem positioned within an axially-extending cavity of the annular body. The stem is coupled to the cap such that rotation of the cap relative to the annular body drives the cap and the stem axially relative to the annular body to adjust the valve.
US09897227B2	Self-acting pressure drain valve A self-acting pressure activated drain valve includes at least one inlet configured to receive a fluid. A drainage passage delivers the fluid to at least one outlet where the fluid is expelled. The self-acting pressure activated drain valve further includes a flexible diaphragm configured to operate in an open position and a closed position based on a pressure. The flexible diaphragm is normally biased in the open position such that fluid is delivered from the at least one inlet to the at least one outlet via the drainage passage. The pressure, however, initiates the closed position such that air is prevented from flowing through the drainage passage.
US09897219B2	Pressure reduction valve and gas supply device The pressure reduction valve includes: a cylindrical portion, a piston and a spring. The cylindrical portion includes an inlet communicating with the primary side flow path and an outlet communicating with the secondary side flow path. The piston fitted into the cylindrical portion is slidable along an axis direction of the cylindrical portion within the cylindrical portion, and defines, within the cylindrical portion, a space communicating with the inlet and the outlet. The spring applies, to the piston, a force acting toward the space. The outlet is displaced in one direction from the center of the piston when seen in the axis direction. The force applied to the piston by the spring is distributed so as to deviate from the center of the piston to the side of the outlet.
US09897218B2	Ball valve with load varying mechanism, and method of operating the same A ball valve is provided. The ball valve includes at least one load varying mechanism provided in the static body assembly. The load varying mechanism includes a biasing member pressing one of the ball seat seals against the outer surface of the ball of the ball valve with a variable sealing load force applied on the ball, toward the ball and coaxial with the direction of the fluid. The load varying mechanism also includes a movable member operatively connected to a cam and to the biasing member, a rotation of the cam translating the movable member coaxially to the direction of the fluid, in order to variably load the biasing member toward or away from the ball, based on the different positions of the ball.
US09897199B2	Hydraulic circuit for power transmission device of vehicle A fitting clearance of a relief valve functions as an air bleeding orifice. When a discharge pressure reaches a relief pressure so that the relief valve turns into a relief state, a spool is moved so as to limit flow-out of hydraulic oil through the fitting clearance. As a result, generation of air trapping is suppressed by air bleeding function of the relief valve in a closed state. Air in a discharge oil passage is discharged quickly in the initial period of the startup of an electric oil pump, thereby improving rise-up of discharge pressure. During normal pump operation in which the relief valve is held in a relief state, pressure loss due to flow out of the hydraulic oil from the fitting clearance is suppressed and consequently, an electric oil pump having substantially the same discharge performance as conventionally can be used.
US09897195B2	Planetary gear drive A planetary gear drive has needle roller bearings of full roller type as planetary gear bearings for planetary gears. The needle roller bearings have lubrication mechanisms, respectively. Each lubrication mechanism has an annular grease retaining groove. The grease retaining groove is formed on an inner peripheral surface (an outer-race-side raceway surface) of the shaft hole of each planetary gear. Poor lubrication can be prevented from occurring when needle roller bearings of full roller type are employed as the planetary gear bearings.
US09897194B2	Method to control an electric motor of a hydraulic system of a transmission in a vehicle A method to control an electric motor of a hydraulic system of a transmission in a vehicle; the hydraulic system has a circulation pump, which allows a lubricant oil to circulate, and/or an actuation pump, which provides the hydraulic pressure needed to operate the transmission, a carrier shaft on which the pumps are mounted, and the electric motor designed to cause the rotation of the carrier shaft; the steps provided are: determining a requested torque to be applied by the electric motor to the carrier shaft; determining a requested rotation speed to be imparted by the electric motor to the carrier shaft; and controlling the electric motor so as to pursue the requested torque and the requested rotation speed.
US09897182B2	Transmission system An exemplary transmission system (TS) includes a clutch module (CM) having an input (In) and a first and a second output (O1, O2). A first clutch device (B, B1, C2) provided with a first actuator is present between the first output and the input, and a second clutch device (C, B2) with a second actuator is present between the second output and the input. The transmission system also includes a transmission module (TM), with an output (Out) and a first and a second input (i1, i2). A first partial transmission provided with at least one transmission (VAR) is present between the first input and the output, and a second partial transmission provided with at least one further transmission or a mechanical connection is present between the second input and the output. Two outputs (O1, O2) of the clutch module are connected to the two inputs (i1, i2) of the transmission module.
US09897180B2	3D push pull chain A push pull chain is provided with chain links that are connected to each other by respectively one chain joint, designed in a space-efficient manner. The chain joints of a first chain section with their joint axes have a first orientation, whereby the joint axes of the chain joints of a second chain section are arranged in a second orientation that is twisted around the longitudinal axis of the push pull chain or whereby they can be set to this orientation. In addition, a pertaining chain drive is provided.
US09897162B2	Two-dimensional vibration isolator An apparatus is provided for vibration damping and isolation. The apparatus includes an annular spring portion including a resilient member that is substantially equally resilient in two dimensions, an annular bellows portion including at least two pairs of diametrically opposed bellows providing damping in the two dimensions, and a rigid connection member coupling the annular spring portion and the annular bellow portion in parallel to one another.
US09897145B2	Coated component A coated component, in particular to a rolling bearing part, made from a metallic substrate (2), and a PVD coating (3), which is applied to the substrate (2), formed of chromium and having a thickness of less than 2 μm, wherein the PVD coating (3) forms the surface of the component, and a compound of chromium and at least one further element is formed on the component surface.
US09897135B2	Extendible working machine An extendible working machine has a rotation/drive section, a working section, and a rod section which connects the rotation/drive section and the working section, transmits rotational force to the working section, and can be extended and retracted. The rod section has a tube body which can be extended and retracted, and also has a shaft body which extends in the axial direction within the tube body and which can be extended and retracted together with the tube body. The shaft body has a pipe shaft which is supported within the inner tube in a rotatable manner. Helical grooves are formed in the surface of the drive shaft. The drive shaft is connected to the pipe shaft so the pipe shaft can move in the axial direction along the outer surface of the drive shaft and so the rotation of the drive shaft is transmitted to the pipe shaft.
US09897128B2	Part fitted with fastening member, and method of attaching the same An object of the invention is to resolve the inconvenience of separately handling a nut member and a bolt member and improve workability in fastening and fixing a part. There is adopted a part fitted with a fastening member including: one fastening member that includes a high-rigidity screw portion, a low-rigidity crushable portion, and a locking portion provided against a member to which a part is attached; another fastening member that includes a screw portion tightly screwed with the high-rigidity screw portion to be able to crush the crushable portion; and a part that is temporarily fastened and held between the one fastening member and the other fastening member while the two screw portions are loosely screwed together.
US09897119B2	Control system for hybrid construction machine A control system for a hybrid construction machine includes a turning-regeneration-use switching valve that opens when a pressure detected by a pressure detector reaches a turning-regeneration starting pressure, so as to introduce the working fluid from a turning circuit to a regenerative motor, an operating-state detector that detects an operating state of a fluid pressure cylinder; and a cylinder-regeneration-use switching valve that opens based on a detection result of the operating-state detector, so as to introduce the working fluid from the fluid pressure cylinder to the regenerative motor. When the turning regeneration is performed alone, the working fluid from the turning circuit is introduced into the regenerative motor without pressure reduction, When the turning regeneration and the cylinder regeneration are simultaneously performed, the working fluid from the turning circuit is reduced in pressure, joins the working fluid from the fluid pressure cylinder, and is introduced into the regenerative motor.
US09897117B2	Electromagnetic powertrain system An electromagnetically operated powertrain system is provided. The system includes a plurality of cylinder assemblies arranged in parallel at least partially along a vehicle. Each of the cylinder assemblies may include one or more cylinders, one or more electromagnetic devices secured to at least one of the ends of each cylinder, one or more pistons reciprocatingly received in the cylinders, and a piston rod coupled to the pistons. Each of the pistons includes a permanent magnet that creates a magnetic field interacting with an electromagnetic field generated by each of the electromagnetic devices. A pulling and/or pushing force may be selectively generated by the magnetic field and the electromagnetic field to enable the pistons to reciprocate within the cylinders. A crankshaft is coupled to the piston rods of the plurality of cylinder assemblies and directly coupled to at least one of front and rear axles of a vehicle.
US09897116B2	Method of detecting failure of a servo-valve, and a servo-valve applying the method A method of detecting failure of a two-stage servo-valve in which the power-controlling movable member is connected to the rotor of a torque motor of a pilot stage by mechanical feedback. A malfunction signal is generated in response to detecting that the rotor of the torque motor has engaged a stop. The invention also provides a servo-valve for implementing such a method.
US09897111B2	Aspirating induction nozzle with flow transition An aspirating induction nozzle is designed to ensure that the discharge velocity is always at or above the governing guidelines while simultaneously leveraging physics to consistently induce fresh air with no moving parts. To achieve this, the flow rate from the fan at the inlet of the nozzle must be accelerated. A frusto-conical transitional flow impinger provides a mechanism to effectively control the flow velocity in the region from the discharge of the fan impeller through the nozzle body. The addition of the impinger provides a mechanism to ensure that flow velocities are always constant or increasing until the discharge plane of the nozzle body, thereby offering a means to optimize the design of the nozzle for the given flow and/or operational pressure drop requirements, while sustaining a tuned venturi effect for steadfast operation in a dynamic environment.
US09897110B2	Centrifugal compressor The centrifugal compressor (1) includes: an impeller (3); and a casing (2) accommodating the impeller (3). The casing (2) includes: an inlet (6); an impeller-accommodating portion (14) in which the impeller (3) is disposed; an annular flow passageway (5) formed around the impeller (3); an outlet (9) communicating with the annular flow passageway (5); and an annular chamber (11) formed around at least one of the inlet (6) and the impeller-accommodating portion (14). An inner circumferential surface (2a) of the casing (2) facing the impeller-accommodating portion (14) is provided with a groove (12) which communicates the impeller-accommodating portion (14) and the annular chamber (11) with each other and which is formed over the entire circumference of the inner circumferential surface (2a). In addition, the annular chamber (11) communicates with another space only through the groove (12).
US09897094B2	Axial flow fan An axial flow fan is provided. The axial flow fan includes an impeller and a fan frame. The impeller has a maximum outer diameter. The fan frame includes a first body and a second body. The first body includes a plurality of connecting elements and a base. The connecting elements are connected to the base. The second body is a hollow body, and used for disposing around the impeller. The second body includes a flow passage having a minimum inner diameter. The minimum inner diameter of the flow passage is not larger than the maximum outer diameter of the impeller. Therefore, the size of the second body does not restrict the maximum outer diameter of the impeller, and the shape of the impeller and the shape of the fan frame can be designed flexibly according to the practical demand.
US09897093B2	Bearing cooling flow and energy recovery systems An air cycle machine is provided. The machine includes a housing configured to enable airflow therethrough, a fan disposed within the housing and configured to rotate within the housing, and at least one aperture formed in the housing and configured to allow airflow through the at least one aperture from a cooling airflow path of an air cycle machine and into the housing. The at least one aperture is configured to optimally direct airflow passing therethrough toward the fan.
US09897092B2	Compressor and turbo chiller A compressor (2) characterized by being equipped with: a rotary shaft (12); multiple impellers attached to the rotary shaft; a main flow path that guides a fluid from the prior-stage impeller to the latter-stage impeller; a chamber (31) that forms a circle centered around the axial line and connects to the main flow path; a suction nozzle (32) that guides the fluid from the outer circumferential side toward the inner circumferential side in the chamber; multiple movable vanes provided in the main flow path at intervals in the circumferential direction of the axial line and capable of moving and thereby adjusting the flow volume of the fluid passing through the main flow path; and a drive mechanism (42) that is provided at one side in the circumferential direction of the suction nozzle (32) within the chamber (31), and that changes the angle of the multiple movable vanes. In addition, of the one side and the other side in the circumferential direction within the chamber (31), the suction nozzle (32) is inclined toward the other side so as to increase the flow volume of the fluid toward the other side.
US09897081B2	Heating positive-displacement liquid pump Liquid pump (1) comprising: a cylinder (24), an inlet valve (47a) for feeding the liquid into said cylinder (24), a discharge valve (47b) for discharging the liquid out of said cylinder (24), a piston (52) actuated by a transmission tube (51) and sliding in said cylinder (24) so as to draw said liquid into said cylinder (24) and then to expel it from said cylinder (24). The cylinder (24) comprises at least one heating cartridge (41) in order to heat the liquid in said cylinder (24).
US09897077B2	Solar automatic heat collecting and equalizing tube, automatic heat equalizing trough-type module, solar-thermal complementary power generation system comprising the same, and power generation method using the same A solar automatic heat collecting and equalizing tube, including: a glass tube, an absorption tube, and a baffle. The glass tube is sleeved on the absorption tube. The absorption tube is coated with a heat absorption layer. The space between the glass tube and the absorption tube is vacuum. The baffle is disposed in the inner cavity of the absorption tube and is configured to drive a fluid in the absorption tube to tumble up and down alternately. The baffle is spiral in shape and fixed in the absorption tube.
US09897067B2	Swallow tail airfoil The aerodynamic element has a cross section in an airflow direction with a trailing edge (10c). The aerodynamic element (10) further includes a non-symmetrical swallow tail shaped cavity body (1, 2) attached to the trailing edge (10c) of the aerodynamic element (10). The aerodynamic element (10) is e.g. applied in a rotor blade for a wind turbine.
US09897064B2	Ignition coil for internal combustion engine An ignition coil for an internal combustion engine is provided which is equipped with a high-voltage connector terminal and a high-voltage output terminal. The high-voltage connector terminal is connected to a secondary coil. The high-voltage output terminal is to be joined to a spark plug. The high-voltage connector terminal has a tip portion with a rounded surface which elastically establishes an electrical contact with the surface of the high-voltage output terminal. The rounded surface serves to minimize the wear of the high-voltage connector terminal and the high-voltage output terminal which arises from rubbing therebetween during assembling or operation of the ignition coil, thus avoiding the adhesion of foreign objects to the contact surfaces and ensuring the stability of electric communication between the high-voltage connector terminal and the high-voltage output terminal.
US09897063B2	Glow plug with pressure sensor A glow plug (100) includes: a housing (130) having a metal shell (110) and a cap unit (120); and a heater unit (150). A coupling member (180) is joined with the housing (130) and is also joined with the heater unit (150) at its edge portion (188), so as to enable the heater unit (150) to move along an axis line O and couple the heater unit (150) with the housing (130). When the edge portion 188 of the coupling member 180 is irradiated with a laser, at least part of the edge portion (188) melted by laser welding fills a gap (50) between the coupling member (180) and the heater unit (150) to form a welded part (210). As a result, even when there is a gap prior to welding, the weld strength between the coupling member (180) and the heater unit (150) can be maintained.
US09897061B2	Method for controlling engine knocking A method for controlling engine knocking, in which a retarded timing is recovered based on a retarded timing amount learned when the engine knocking occurs during driving of a vehicle, includes a first process of retarding an ignition timing based on the previously learned retarded timing amount in a reference engine operating condition entered during driving of the vehicle. A second process recovers the retarded timing when a first condition in which a time duration acquired by accumulating a driving time under the reference engine operating condition is equal to or more than a reference time duration and a second condition in which the engine knocking does not occur while driving under the reference engine operating condition are satisfied.
US09897058B2	Fuel injector A fuel injector for use in an internal combustion engine includes a valve member that is moveable within a bore of an injection nozzle so as to be engageable with a valve seat region to control fuel delivery through one or more nozzle outlets, an injector body housing an actuator that is operable to move the valve member within the bore, and defining an accumulator volume for storing high pressure fuel. The fuel injector includes a damping chamber in fluid communication with the accumulator volume through a fluid passage, the damping chamber serving to reduce pressure wave activity within the accumulator volume.
US09897053B2	Fuel cooled injector tip A fuel injector is provided comprising an outer housing, a nozzle housing disposed within the outer housing, a flow path between the outer housing and the nozzle housing, the flow path being coupled to a low pressure fuel source, and a circumferential gap in flow communication with the flow path and extending about a tip of the fuel injector between an outer surface of the nozzle housing and an inner surface of a combustion shield adjacent the injector tip. The circumferential gap is in flow communication with a drain gap between the outer housing and a bore for receiving the fuel injector, the drain gap routing the low pressure fuel away from the injector tip.
US09897042B2	Main fuel jet and nozzle assembly for a carburetor A carburetor includes a body with an air intake path, a fuel pump and a fuel pressure regulator and having a main fuel jet and nozzle assembly with a main fuel jet releasably coupled to the body of the carburetor. Alternatively, a main fuel jet and nozzle assembly includes a nozzle and check valve retainer formed as a single component. In other embodiments, a carburetor is provided having a fuel pump and fuel pressure regulator positioned on the same side of the body. A fuel pump and metering chamber diaphragm sandwiched between the body of the carburetor and a pump body and cover, separates a pump chamber from a pulse chamber of the fuel pump and separates a fuel chamber from an air chamber in the fuel pressure regulator.
US09897036B2	Tightening structure for cylinder head bolt A cylinder head bolt inserted into a cylinder head is threadingly engaged with an engine casing comprised of a cylinder and a crankcase to tighten the cylinder head and the engine casing firmly together. Between a rotation operating part, which is provided in a head of the cylinder head bolt, and an upper surface of the cylinder head, a plain washer and a spring member placed thereabove are interposed. The spring member is capable of exerting an axially acting spring force. A first frictional resistance between the rotation operating part and the spring member is so chosen to be lower than a second frictional resistance between the spring member and the plain washer and a third frictional resistance between the plain washer and a bearing surface on the cylinder head.
US09897032B2	Fuel injection device There is provided a fuel injection device. Based on a current intake air pressure and a previous intake air pressure of an engine at the predetermined crank position, an intake air pressure variation of the engine at the predetermined crank position is calculated as a measured intake air pressure variation. Based on the current rotational speed and the previous rotational speed of the engine at the predetermined crank position, and a fully-closed-state intake air pressure conversion data item, the fully-closed-state intake air pressure variation of the engine at the predetermined crank position is calculated. The measured intake air pressure variation is corrected based on the fully-closed-state intake air pressure variation. Based on the corrected measured intake air pressure variation, the current rotational speed at the predetermined crank position, and the transient fuel injection quantity conversion data item, the transient fuel injection quantity at the predetermined crank position is determined.
US09897027B2	Methods and systems for adjusting EGR based on an impact of PCV hydrocarbons on an intake oxygen sensor Methods and systems are provided for estimating an impact of PCV hydrocarbons on an output of an intake oxygen sensor. In one example, a method may include disabling EGR flow when the impact of PCV hydrocarbons on the output of the intake oxygen sensor is above a threshold. The impact of the PCV hydrocarbons on the output of the intake oxygen sensor may be based on a difference between the output of the intake oxygen sensor and a DPOV sensor when EGR is flow and a difference between the output of the intake oxygen sensor and expected blow-by when EGR is not flowing.
US09897025B2	Method for controlling an internal combustion engine A direct fuel injection internal combustion engine fluidly coupled to an exhaust aftertreatment system is described and includes a plurality of fluidly coupled exhaust purifying devices and an exhaust gas sensor. A method of controlling the engine includes, activating, via a heater controller, a heating element of the exhaust gas sensor in response to starting the internal combustion engine. An exhaust gas feedstream is monitored to determine a temperature of the exhaust gas sensor. Engine control to effect heating of one of the exhaust purifying devices is permitted only when a temperature of the exhaust gas sensor is greater than a threshold temperature.
US09897018B2	Vehicle speed control apparatus of industrial vehicle A vehicle speed control apparatus of an industrial vehicle has a controller that determines a target engine speed by PI control based on a deviation between a target vehicle speed and an actual vehicle speed. The controller controls an upper limit of the target engine speed according to an actual engine speed.
US09897009B2	Flexible thermal blanket Aspects of the disclosure are directed to a flexible thermal blanket assembly, comprising: a stack-up of material layers that are configured to wrap around a component, a plurality of snaps configured to be mechanically fastened through the material layers, and a cap configured as a baffle to prevent thermal energy located at an exterior of the thermal blanket assembly from entering an interior of the thermal blanket assembly when the thermal blanket assembly is assembled.
US09897008B2	Conduit assembly and method of utilization A conduit assembly and method of utilizing the assembly generally extends along a centerline for detachable engagement to a component in an axial direction. The assembly may include a body having an internal, cylindrical, surface with a first surface portion located axially adjacent to a second surface portion. The first portion is circumferentially continuous and the second portion extends circumferentially by about 180 degrees or less. A saddle is axially aligned to the second portion and detachably connects to the body. The saddle extends circumferentially by about 180 degrees or more. A conduit is received in the body and rigidly secured to the body via the saddle. A circumferentially continuous sealing interface is carried between the first portion and the conduit, and is constructed and arranged to slide axially with respect to the first portion and the conduit.
US09896996B2	Reducing turbocharger ice damage The present technology provides methods and systems for reducing ice buildup in a closed engine breather system. The systems comprise an air inlet duct, a compressor wheel and a compressor cover. The compressor cover comprises a breather gas port. The breather gas port is placed in the compressor cover at a location within close proximity to the leading edge of the compressor wheel so that the compressor wheel is capable of removing ice that accumulates at the breather gas port. The present technology also provides methods that include providing an air inlet duct, a compressor wheel, and a compressor cover with a breather gas port in the compressor cover. In this manner the compressor wheel can grind or shave off ice that accumulates at the breather gas port.
US09896991B2	Exhaust-gas-turbocharged internal combustion engine having at least two turbines and switchable outlet openings, and method for operating an internal combustion engine of said type Systems and methods are provided for controlling boost pressure in an engine system with a parallel turbocharger. One example method includes, responsive to a first condition, deactivating a first compressor of a first turbocharger, activating each first exhaust valve of each cylinder of an engine, and deactivating each second exhaust valve of each cylinder of the engine to flow exhaust gas from the engine to a second turbocharger. The method further includes, responsive to boost pressure exceeding a threshold, maintaining deactivation of the first compressor, reactivating each second exhaust valve to flow exhaust gas from the engine to both the first turbocharger and second turbocharger, and driving an electric assist device via a first turbine of the first turbocharger.
US09896988B2	Three way catalytic control method and system for decreasing fuel consumption and vehicle having the same A three-way catalytic control method for reducing fuel consumption is provided. The method includes determining whether oxygen storage capacity of the three-way catalyst is under condition of increasing oxygen, when condition of performing O2 purge control for the three-way catalyst is detected and performing O2 purge control by applying a predetermined O2 purge time period to which a set initial value of oxygen of OSC is applied, when the OSC is not under the condition of increasing oxygen. The O2 purge control is performed by applying O2 purge time period for a deteriorated product based on an oxygen sensor or O2 purge time period for on board diagnosis, when an increase amount of the calculated O2 purge time period is equal to or greater than the O2 purge time period for the deteriorated product during the O2 purge control.
US09896980B2	Exhaust aftertreatment supplying a reducing agent The present disclosure relates to on-vehicle systems and methods for mixing an NOx reductant solution from a concentrated source of NOx reductant and water. The mixed DEF is then used to treat exhaust from the vehicle to reduce pollutants.
US09896959B2	Pitch angle measuring system and method for wind turbines The present invention relates to a wind turbine and a measuring system for determining the pitch angle of at least one blade relative to a hub of a wind turbine. The measurement comprises a first angular-velocity sensor (130) measuring a first angular velocity (φ) around a first sensor axis (e1), the first angular-velocity sensor (130) fixedly attached to the at least one blade (100) with a first predetermined orientation selected to produce a first projection of the main rotational axis (32) onto the first sensor axis (e1), a second angular-velocity sensor (140) measuring a second angular velocity (β) around a second sensor axis (e2), the second angular-velocity sensor (140) fixedly attached to the at least one blade (100) with a second predetermined orientation selected to produce a second projection of the main rotational axis (32) onto the second sensor axis (e2), the first sensor axis (e1) and the second sensor axis (e2) being linearly independent, and a first computational unit (160) computing a computed pitch angle (θ1c) based on of the first angular velocity (φ) and the second angular velocity (β).The invention relates also to a method for determining an azimuthal position and azimuthal rotational velocity of the at least one blade relative to the nacelle, the azimuthal position being defined by the rotational motion of the hub relative to the nacelle.
US09896950B2	Turbine guide wheel A turbine stator wheel of a gas turbine with a plurality of stator vanes spaced apart around the circumference is provided. Two adjacent stator vanes form a passage each between the suction side of the one stator vane and the pressure side of the other stator vane starting from the vane trailing edge, which includes a constant passage portion in which the passage has a substantially constant passage cross-section. The constant passage portion has an inlet area and an outlet area. Each stator vane forms on the pressure side a rear area that extends, starting from the vane trailing edge adjoining the constant passage portion as far as the inlet area of the passage portion, and on the pressure-side forms a front area that extends upstream of the rear area. Each stator vane has on the pressure side a convex pressure-side contour.
US09896946B2	Gas turbine engine rotor assembly and method of assembling the same A rotor assembly includes a rotor disc including a plurality of circumferentially-spaced diskposts and a plurality of dovetail slots. Each dovetail slot is defined between a pair of circumferentially-adjacent diskposts. A plurality of rotor blades are coupled to the rotor disc. Each rotor blade includes a dovetail portion that is configured to slidably engage a respective dovetail slot. A plurality of platform sections are coupled to the rotor disc such that each platform section is adjacent a respective rotor blade. Each platform section includes a diskpost slot that is configured to receive one of the plurality of diskposts such that each dovetail slot receives a respective dovetail portion and at least a portion of at least one of the platform sections adjacent the rotor blade.
US09896944B2	Forming a secondary structure directly onto a turbine blade A process and apparatus for solid freeform fabrication and repair of components on existing bodies (such as turbine blades), the innovative process and apparatus as well as the resultant product having the following advantages: a) Can build on existing 3-D surfaces. Not limited to horizontal flat surfaces, b) Usable for metals that are difficult to weld. c) Robust process that is adaptable to new damage modes. d) No shielding of the melt pool by inert gas is needed. e) Wide range of powder sizes.
US09896942B2	Cooled turbine guide vane or blade for a turbomachine A turbine airfoil has a suction side wall and a pressure side wall of an airfoil cavity, through which a cooling fluid flows for cooling of the side walls. The suction side wall has one or more protrusions extending therefrom into the airfoil cavity. The protrusions are arranged such that: a number of the one or more protrusions on the suction side wall is higher than a number of protrusions on the pressure side wall; and/or a protrusion density on the suction side wall is higher than a protrusion density on the pressure side wall, and/or a total protrusion surface area on the suction side wall is larger than a total protrusion surface area on the pressure side wall, so that the heat transfer from the suction side wall to the cooling fluid is higher compared to that of the pressure side wall during operation of the turbomachine.
US09896938B2	Gas turbine engines with internally stretched tie shafts A tie shaft for a rotating group of an engine core includes a cylindrical body having an internal surface and an external surface and extending between a forward end and an aft end. The tie shaft further includes a first group of internal grooves on the internal surface of the cylindrical body proximate to the forward end and a second group of internal grooves on the internal surface of the cylindrical body proximate to the aft end.
US09896930B2	Three-dimensional reservoir pressure determination using real time pressure data from downhole gauges Well production rate, injection rate and pressure data are measured in an existing reservoir using in situ real time measurement gauges. Production and injection rates are entered as input to a history match model in a data processing system. Measures of projected reservoir pressure with time are generated by running the updated history match model using a reservoir simulator. Actual reservoir data values obtained at a given date or time slice from reservoir production are compared with projected data obtained from the reservoir simulator for that same date or time slice. At each time slice, the real-time pressure values measured at the wellbore are converted into reservoir pressures through a well model. The real time reservoir pressure values and the projected reservoir pressure are then used to interpolate the reservoir pressure array over the entire three dimensions using a geostatistical modeling process.
US09896917B2	Oil production intensification device and method The oil production intensification method includes injecting the reagent into the reservoir and treating the bottom zone of the well with high voltage pulse discharges with an electric discharge device continuously traveling from bottom to top in the atmosphere of such reagent. The number of pulses of such high voltage pulse discharges is set subject to the real porosity of the reservoir and the empirical dependence of the number of pulses of high voltage pulse discharges per meter of the reservoir and porosity of rocks pre-estimated with the core material. After the electric discharge device stops traveling up, the treatment with high voltage pulse discharges also stops, and the well is pressurized until the pressure stabilizes in it. Then, the bottom hole area of the well is further treated with high voltage pulses as the electric discharge device travels from top to bottom. Whereby an intensified oil production is realized, from 2 to 20 times more oil may be extracted.
US09896914B2	Downhole tubular expansion tool and method An expansion tool includes a housing and a hydraulic power section for stroking an expander on a pulling mandrel through a bore of an expandable liner, the expansion tool including a ratcheting reaction assembly, having a ratchet rack and a ratcheting component thereon, that engages a proximal end of the liner to prevent axial movement of the liner as the expander is drawn through a portion of the bore of the liner to expand the liner. The ratcheting reaction assembly remains engaged with the proximal end of the liner as the housing is repositioned uphole to permit staged expansion of the liner using the expander. The expansion tool improves sealing and structure integrity of the expanded liner within the casing by maintaining the liner in a position throughout the staged expansion process.
US09896904B2	Rupture disc secondary seal assembly and related methods A rupture disc assembly having a secondary seal positioned over the coupling area between the rupture disc and the tool housing. The secondary seal may be, for example, sealing tape, an o-ring, liquid sealant, metallic sealing tape, etc., or a combination of two or more of these elements.
US09896900B2	Sealing apparatus A sealing apparatus for sealing a well bore is described. The sealing apparatus comprises a sealing element adapted to be moved from a run-in configuration to a set configuration, a first back-up layer and at least one second back-up layer sandwiched between the sealing element and the first back-up layer. The at least one second back-up layer comprises a thinner material than the first back-up layer. The first back-up layer and the at least one second back-up layer are adapted to be moved from the run-in configuration to the set configuration under the action of the sealing element.
US09896899B2	Downhole tool with rounded mandrel A downhole tool for use in a wellbore, the downhole tool including a mandrel further comprising a first end and a second end. The second end includes a first outer surface area and a second outer surface area. The first outer surface area further includes at least one rounded segment that has a radius of curvature in longitudinal cross-section.
US09896890B2	Gooseneck conduit system A gooseneck conduit system for use with a telescoping joint of a subsea riser. In one embodiment, a riser telescoping joint includes a tube and a gooseneck conduit assembly affixed to the tube. The gooseneck conduit assembly includes a gooseneck conduit extending radially from the tube, and a tenon projecting from a rear face of the gooseneck conduit. The width of the tenon increases with distance from the rear face. The riser telescoping joint also includes a mortise channel extending along the length of the tube. The mortise channel is interlocks with the tenon and laterally secures the gooseneck conduit assembly to the tube.
US09896886B2	Insulation enclosure with compliant independent members An example insulation enclosure includes an outer shell having an open end and a top end, and an inner shell arranged within the outer shell and including a plurality of sidewall members and a top member. Each sidewall member is independently moveable relative to one another and to the top member, and the plurality of sidewall members and the top member each include a support member and insulation material positioned on the support member. One or more compliant devices arranged between the outer shell and at least one of the plurality of sidewall members and the top member, the one or more compliant devices biasing the at least one of the plurality of sidewall members and the top member against adjacent outer surfaces of a mold disposable within the inner shell.
US09896883B1	Coilable shade A coilable shade includes a shade having a head end and a tail end. The head end includes a hanger portion. A shaft is fixed to the tail end of the shade. A shade holding device includes two pivotal portions opposite to each other. The shaft is coupled to the two pivotal portions. A portion of the shade coiled around the shaft is received in the shade holding device and is held by an elastic enveloping strap. The disadvantage of failure in retaining in a desired length in the conventional shade device that can only provide a fully extended state or a fully coiled state is, thus, solved.
US09896880B2	Glazing panel comprising glass sheets linked together via spacers and corresponding production method The invention concerns a glazing panel comprising first (5) and second (5) glass sheets linked together via at least one spacer (8) which holds them a certain distance apart from one another and, between said glass sheets (5), an inner space (4) comprising at least one first cavity (41), in which there is a vacuum of less than 100 mbar and which is closed by a peripheral seal disposed at the periphery of the glass sheets, around said inner space (4), the seal (1) being a metal seal rigidly connected respectively to the first and second glass sheets. According to the invention, the metal seal (1) further comprises at least one hollow metal tube (11) of which a first end (111) communicates with the inner space (4) and a second end (112) communicates with the outside of the panel, the second end (112) comprising means for blocking the tube. According to the invention, the tube comprises at least one gas trap (113) rigidly connected to the inside of the tube (11).
US09896875B2	Adaptive ventilating window for different weather conditions A window frame supports a central panel, with two adjacent pivoting side panels. The pivoting side panel includes two frames coupled by a hinge. Two side panel pivot actuators couple to the pivoting side panels. Movable awnings support photovoltaic modules to provide a power source. An awning open-close actuator couples to the movable awnings. Indoor and outdoor sensors send measurements to the controller that, based on the measurements, selectively operates the awning open-close actuator and the side panel pivot actuators.
US09896867B2	Component and low profile flexible latch assembly Latch assembly including a latch arm, having first and second length edges and first and second width edges. The latch arm includes a latch pawl, a pivot connector, and a stabilizing member, positioned in a plane. The latch pawl connected to the first width edge and providing spring force resisting deflection non-parallel to the plane. The pivot connector and stabilizing member formed within an area of the latch arm. The stabilizing member extending distally relative to the second width edge to the pivot connector, and providing spring force resisting deflection parallel to the plane. The component and latch assembly including a component having first and second faces being adjacent and perpendicular. The latch arm rotatably mounted on the second face between latched and unlatched positions. Assembly including an embossment positioned to deflect the latch pawl during latching so the latch arm sits raised upon the embossment in the latched position.
US09896862B1	Tent and canopy apparatus A tent including a pull hub is disclosed. The pull hub may be a side pull hub that may include a pull cord having a distal end and a proximal end coupled to the hub, an upper hub element, and a lower hub element. The tent may further include a plurality of tent support poles coupled to the hub. The tent may further include a fabric material coupled to the support poles. The side-pull hub may include an opening on a side of the hub through which the distal end of the pull cord is passed through to facilitate tent erection by moving the upper and lower hub element together upon user actuation.
US09896861B2	Post holder This invention relates to railings, and more particularly to post holders for hollow posts. The post holders of the present invention comprise a shaft extending from a base, and in use a post slides over the shaft of the post holder.
US09896860B2	Structural support system and methods of use The present disclosure describes a base structural building module employing a core structural member having an array of upwardly and outwardly and downwardly and outwardly extending braces or arms extending therefrom. Tubular cans are mounted at the ends of each of the upper and lower arms to receive piles. One upper arm is aligned and paired with one lower arm and the pair's respective cans are aligned about their can axis. The modules employ flexible design by varying the lengths of the arms and their respective inclination or declination angles. Modules can be stacked one on top of another (and secured) to form multi-tiered structural building jackets for building vertical structures such as, for example, oil and gas platforms used onshore or offshore as well as other structures. Each tier can also comprise multiple modules joined laterally together to provide a wide variety of potential template configurations and building applications.
US09896857B2	Pool cleaner light module Embodiments of the invention provide a pool cleaner receiving fluid flow from a pool hose, the pool cleaner comprising a supply mast configured for connection to a pool hose and directing fluid flow from the pool hose and a generator positioned within the pool cleaner. The pool cleaner further includes a paddle wheel coupled to the generator, the paddle wheel and the generator generating electric power using the fluid flow directed through the pool cleaner and control circuitry coupled to the generator, the control circuitry receiving the generated power from the generator for providing energy to operate at least one function of the swimming pool cleaner.
US09896850B2	Thermoplastic-based building product and related methods One exemplary embodiment is directed to a thermoplastic-based building product having a front face with a length and a width, an opposing back face, opposing top and bottom edges each with a thickness. The building product comprises at least one thermoplastic-based support layer, and at least one reinforcing flexing layer having a coefficient of linear thermal expansion (CLTE) of less than or equal to about 15 ppm/° C. over the temperature range of −20° C. to 70° C. The at least one reinforcing flexing layer is at least partially embedded in the at least one thermoplastic-based support layer along a longitudinal axis of the building product.
US09896844B2	I-joists and method of fabrication thereof An I-joist comprising a web and flanges, the web being connected on each longitudinal edge thereof to a flange, wherein the I-joist further comprises chords, the chords being connected to the web on at least one side of the web. The web may comprise openings in between the chords. The I-joist is fabricated by connecting a flange on each longitudinal edge of a web and connecting chords on at least one side of the web, the web being provided with openings.
US09896838B2	Concrete panel and concrete panel connector structure for forming reinforced concrete building components A concrete panel system includes first, second, and third rectangular precast concrete panels, each defining a respective top edge, bottom edge, and first and second lateral edges. A first type connector is formed in the concrete material at least along the top edge of the first panel and along the first lateral edge of the first panel. A second type connector is formed in the concrete material at least along the second lateral edge of the second panel, and along the bottom edge of the third panel. The first type connector and the second type connector are configured to connect together so as to form a cavity between the respective panel edges. This cavity extends along the first lateral edge of the first panel to facilitate positioning rebar between adjacent panels.
US09896834B1	Tree house elevated in a simulated tree, and method of making A tree house propped upon a simulated tree trunk has a platform, a cabin thereon, a main support column supported in a ground anchor, a plurality of diagonal struts, and a variety of simulate tree dressings for the column and struts. The cabin is built upon the platform and forms an inner living space that is served with potable water utilities, waste water utilities, and public-utility electric service. The main support column extends downward from the platform about a relative center of mass of the platform and cabin together, to ultimately sink into the ground anchor. The plurality of diagonal struts extended diagonally downward from the cabin radially spaced away from where the column extends downward from the platform, and join the column intermediate the platform and ground anchor. There furthermore are simulated tree trunk dressing covering the column, and, simulated tree branch dressing covering the struts.
US09896832B2	Percolation block element, percolation block, and transport unit A percolation block element having a base wall and hollow columns. With two identical percolation block elements that are aligned in the same direction, a stack of the two identical percolation block elements can be formed. The percolation block element has an axial symmetry of 180° or less. With two identical percolation block elements arranged rotated by 90° relative to one another about a rotational axis, the column tips of the first percolation block element can be introduced into the column tip receptacles of the second percolation block element, and an operating distance can be formed between a first base wall and a second base wall.
US09896830B2	Dual flush handle control Disclosed are various embodiments for a dual flush handle system. A first handle lever is configured to rotate in a direction by a first predetermined angle of rotation to initiate a first flush of a toilet. A second handle lever is configured to rotate in the direction about a second predetermined angle of rotation to initiate a second flush of a toilet.
US09896826B2	Touch-control faucet The faucet includes a main body, a positioning sleeve, a water-saving valve and an activator. The main body has an inlet end, an outlet end, a water channel and an outlet opening communicating with the water channel. The outlet opening is located on a wall of the outlet end. The positioning sleeve is fixed in the inlet end and has a water hole and a passing hole. The water hole communicates with the water channel and the outlet opening. The water-saving valve is disposed between the outlet end and the positioning sleeve and has an operating bar for controlling the water-saving valve to allow water in the water channel to flow toward the water hole. The activator has a pressing cap disposed on the outlet end. The pressing cap is slidable on the positioning sleeve and moves the operating bar when the pressing cap is pressed.
US09896820B2	Operator assist algorithm for an earth moving machine A system and method are provided for assisting a machine operator in controlling a work tool of the machine. In an embodiment, the work tool is set at a first height and the machine is travelling at a first machine speed, resulting in a first work tool or machine load. Based on these factors, a first work tool control mode or second work tool control mode is chosen. In the first work tool control mode, the work tool is manually controlled within a load limit and a work tool height limit, whereas in the second work tool control mode, the work tool load is controlled toward the first work tool load. Based on operator inputs and machine state, as well as other factors such as ground surface, the machine may switch between control modes, or out of automatic work tool control entirely.
US09896813B2	Gelatin solution A method of preventing soil erosion in, among areas, seaside locations, includes drilling holes in the ground and filling the holes with a mixture of the soil and gelatin, and then curing the mixture in situ to form a barrier against soil erosion.
US09896808B2	Safety surface with engineered shock-absorbing base A safety surface with an engineered shock-absorbing base. The base may include one or more engineered resilient mats. The mats may be fabricated of repurposed tire rubber. The mats may be adjoined edgewise. Adjoined mats may be coupled together. The base may overlay a surface. The base may include upward-facing pockets. Interiors of the pockets may receive loose fill. An upper layer may cover the base. The upper layer may bond to the base. The upper layer may seal the loose fill within the safety surface. The upper layer may include poured-in-place surfacing. The upper layer may be textured. The upper layer may include synthetic turf. Impact upon the upper layer may be attenuated by flexion of the base. Mats may be coupled without hardware fasteners. Exterior surfaces of pockets of one mat may be nested into complementarily contoured features of an adjoining mat.
US09896804B2	Two sided multi-ply tissue product The invention provides a multi-ply tissue product having different surface characteristics on each side of the product. The multi-ply tissue product may be formed from two or more plies where one surface is formed by a substantially smooth creped ply and the other surface is formed by a textured through-air dried ply. In this manner the tissue product may be used for both personal care, which requires a soft and smooth surface, and general household wiping, which requires a rough, durable surface.
US09896798B2	Abrasion resistant product A product comprising a plurality of interlaced yarns wherein at least a first yarn having a tensile strength, having a value TS in N/tex, said first yarn containing a plurality of UHMWPE fibers having a titer, having a value T in den, wherein the ratio T/TS is at least 5 den.tex/N. The tensile strength is obtained by adjusting the drawing ratio or the UHMWPE filaments/fibers accordingly. The product shows resistance to abrasion. The product can be a rope or round slings, comprising a sheath/jacket comprising said first yarn.
US09896796B2	Laundry machine and control method of the same A laundry machine and a control method of the same are disclosed. The disclosed laundry machine includes a tub, a drum rotatably installed in the tub, to receive laundry, a washing heater provided at the tub, to heat wash water, a first wash water passage for supplying the wash water from an external water supply source to the drum via a detergent box, a second wash water passage for supplying the wash water from the external water supply source to an interior of the tub while preventing the wash water from passing through the drum, a course selector for selecting one of a plurality of washing courses, and a controller for selectively opening the first wash water passage or the second wash water passage in accordance with the course selected through the course selector.
US09896786B2	Systems and methods for improving and controlling yarn texture A system and method for controlling and improving the consistency of yarn texture in a yarn system. The system and method are configured to monitor, improve and/or control the operating parameters of the yarn system. A plurality of sensors sense the operating conditions and send the sensed conditions to a processor. The processor and/or a user monitoring the system can make adjustments to the operating parameters in a parameter is outside of a predetermined tolerance.
US09896783B2	Modification of continuous carbon fibers during precursor formation for composites having enhanced moldability Methods of producing continuous carbon fibers for composites having enhanced moldability are provided. Discrete regions are introduced into a continuous precursor fiber comprising an acrylic polymer material, such as polyacrylonitrile (PAN), as the precursor fiber is formed. The precursors may be heterogeneous fibers having a second distinct material interspersed in discrete regions with the acrylic polymer material. Alternatively, the precursors may be heterogeneous fibers where laser is applied to the acrylic polymer material in discrete regions to cause localized molecular disruptions. After the continuous precursor fiber is heated for carbonization and/or graphitization, the precursor forms a continuous carbon fiber having a plurality of discrete weak regions. These relatively weak regions provide noncontiguous break points that reduce stiffness and improve moldability for carbon fiber polymeric composites, while retaining high strength levels. Carbon fiber polymeric composites incorporating continuous carbon fibers having the plurality of discrete noncontiguous weak regions are also provided.
US09896774B2	Electrolytic cell for the production of oxidising solutions A three-compartment cell for production of oxidising disinfectant solutions is provided. The intermediate compartment of the cell is separated from the anodic compartment by a fibrous diaphragm in intimate contact with an anion-exchange membrane.
US09896753B2	Bulk amorphous alloy Zr—Cu—Ni—Al—Ag—Y and methods of preparing and using the same A bulk amorphous alloy, including, based on atomic percentage amounts, between 41 and 63% of Zr, between 18 and 46% of Cu, between 1.5 and 12.5% of Ni, between 4 and 15% of Al, between 0.01 and 5% of Ag, and between 0.01 and 5% of Y.
US09896752B2	Stainless steel alloys, turbocharger turbine housings formed from the stainless steel alloys, and methods for manufacturing the same Disclosed is an austenitic stainless steel alloy that includes, by weight, about 22% to about 28% chromium, about 3.5% to about 6.5% nickel, about 1% to about 6% manganese, about 0.5% to about 2.5% silicon, about 0.5% to about 1.5% tungsten, about 0.2% to about 0.8% molybdenum, about 0.2% to about 0.8% niobium, about 0.3% to about 0.6% carbon, about 0.2% to about 0.8% nitrogen, and a balance of iron. The alloy is suitable for use in turbocharger turbine housing applications for temperature up to about 1020° C.
US09896743B2	Method for re-extraction of rare-earth metals from organic solutions and preparing concentrate of rare-earth metals The present invention relates to a method for recovery of rare earth metals (REM) from diluted aqueous acidic solutions comprising steps of liquid-phase extraction of REM into an organic phase and re-extraction of REM from the organic phase. The re-extraction is carried out by precipitation of REM as a solid phase in the form of a poorly soluble salt of a strong acid (pKa<0). Recovery of REM into the concentrate is up to 99% in the course of one stage of the re-extraction.
US09896741B2	Method of producing metal carbonate from an ultramafic rock material A method of producing a metal carbonate from an ultramafic rock material is provided. The method includes providing an ultramafic rock material comprising a metal silicate; reacting the ultramafic rock material with an acid to form a mixture comprising a salt of the metal; contacting the mixture comprising a salt of the metal with oxygen so as to aerate impurities in the mixture and/or to remove residual acid from the mixture; heating the resultant mixture to decompose the salt of the metal to form metal oxide; and reacting the metal oxide with aqueous ammonium carbonate to obtain the metal carbonate. A system for producing a metal carbonate from ultramafic rock material is also provided.
US09896740B2	Method for operating flash vessel The present invention is such that, with H1 being the height from a slurry outlet to a control liquid level, H2 being the height from the control liquid level to the top of a flash vessel, and being the diameter of the flash vessel, 0.35D≦H1≦0.45D, and 0.75D≦H2≦0.85D, and at least one liquid level sensor detects a slurry liquid surface at a control liquid level; when the liquid level sensor detects a slurry liquid surface which has risen, a slurry discharge valve installed on a slurry discharge pipe derived from the flash vessel is opened; and when the liquid level sensor detects a slurry liquid surface which has fallen, the slurry discharge valve is closed, whereby opening and closing of the valve is appropriately controlled thereby to reduce troubles with a steam discharge pipe, the slurry discharge pipe, and the slurry discharge valve.
US09896736B2	Method for manufacturing hot stamped body having vertical wall and hot stamped body having vertical wall The present invention provides a method for manufacturing a hot stamped body having a vertical wall, the method including: a hot-rolling step; a coiling step; a cold-rolling step; a continuous annealing step; and a hot stamping step, in which the continuous annealing step includes a heating step of heating the cold-rolled steel sheet to a temperature range of equal to or higher than Ac1° C. and lower than Ac3° C.; a cooling step of cooling the heated cold-rolled steel sheet from the highest heating temperature to 660° C. at a cooling rate of equal to or less than 10° C./s; and a holding step of holding the cooled cold-rolled steel sheet in a temperature range of 550° C. to 660° C. for one minute to 10 minutes.
US09896734B2	Asparaginic acid kinase III mutant and host cells and use thereof Provided in the present invention is an asparaginic acid kinase, and the 340th amino acid residue in the position of the amino acid sequence of the asparaginic acid kinase corresponding to the amino acid sequence shown in SEQ ID NO: 2 is a non-aspartic acid. The asparaginic acid of the present invention can efficiently relieve the feedback inhibition of L-lysine, and can be effectively used for the production of L-lysine. Also provided in the present invention are host cells comprising genes coding the asparaginic acid kinase and a method for producing L-lysine using the host cells or the asparaginic acid kinase. The asparaginic acid kinase of the present invention or the host cells comprising the asparaginic acid kinase of the present invention is also used to produce L-threonine, L-methionine, L-isoleucine or L-valine. Also provided in the present invention is a method of producing L-aspartyl-4-yl phosphoric acid using the asparaginic acid kinase or the host cells.
US09896729B2	Method for diagnosing a neurodegenerative disease The present invention relates to methods of assessing whether a subject has or is likely to develop a neurodegenerative disease comprising determining whether the subject has a mutation in the C9orf72 gene wherein said mutation prevents or disrupts C9orf72 expression relative to expression in a reference from subjects without the mutation.
US09896721B2	Strategies for high throughput identification and detection of polymorphisms The invention relates to a method for the high throughput identification of single nucleotide polymorphisms by performing a complexity reduction on two or more samples to yield two or more libraries, sequencing at least part of the libraries, aligning the identified sequences and determining any putative single nucleotide polymorphisms, confirming any putative single nucleotide polymorphism, generating detection probes for the confirmed single nucleotide polymorphisms, subjection a test sample to the same complexity reduction to provide a test library and screen the test library for the presence or absence of the single nucleotide polymorphisms using the detection probe.
US09896717B2	Magnetic immuno digital PCR assay The present invention provides methods of detecting an antigen in a sample comprising contacting the sample with affinity agents to form an antigen-affinity agent-label complex, separating the antigen-affinity agent-label complex from uncomplexed components, partitioning label from the separated sample into multiple partitions, and detecting the presence of the label in one or more partitions. Compositions and kits for detecting an antigen in a sample are also provided.
US09896711B2	Fluorogenic or fluorophoric compounds and uses thereof Compounds are provided that are either fluorogenic or fluorophoric. Compositions and articles that include the compounds are also provided. Additionally, methods of detecting a microorganism using the compounds are provided. The compounds are fluorinated and can be used advantageously under acidic conditions.
US09896708B2	Heparosan-glucuronic acid-5-epimerase, and method for producing polysaccharide using same To provide a polypeptide having heparosan-glucuronate 5-epimerase activity, whereby means for producing a polysaccharide in which hexuronic acid residues has been epimerized is provided. Through screening of Achatina fulica cDNA library, a DNA encoding a polypeptide of heparosan-glucuronate 5-epimerase is obtained. The epimerase acts on glucuronic acid residues of N-acetyl heparosan and/or iduronic acid residues of completely desulfated N-acetylated heparin. The polypeptide encoded by the DNA is expressed by insect cells, to thereby yield the polypeptide having heparosan-glucuronate 5-epimerase activity. By bringing the polypeptide into contact with N-acetyl heparosan or completely desulfated N-acetylated heparin, a polysaccharide in which hexuronic acid residues has been epimerized is yielded.
US09896706B2	Method for producing β-glucan It is an object of the present invention to provide a method for producing β-glucan having excellent immunopotentiating effects at a lower cost. Black yeast (Aureobasidium pullulans) is cultured using cells of lactic acid-producing bacteria and/or derivatives thereof as a nutrient source and is allowed to produce β-glucan.
US09896695B2	HAHB11 provides improved plant yield and tolerance to abiotic stress The present invention provides isolated HaHB11 polypeptides and nucleic acids encoding the same. Also provided are methods of introducing a nucleic acid encoding HaHB11 polypeptides into a plant cell, plant part or plant, e.g., to increase tolerance to abiotic stress, to delay development and/or prolong the life span of a plant, and/or to increase yield from the plant. The invention also provides nucleic acids comprising HaHB11 promoter sequences and methods for expressing a nucleotide sequence of interest operably associated with the HaHB11 promoters of the invention in a plant cell, plant part, or plant. Also provided are transformed plants, plant tissues, plant cells and plant seed comprising the nucleic acids, expression cassettes and vectors of the invention.
US09896684B2	Device for nucleic acid extraction using magnetic bead method The present invention provides a device for nucleic acid extraction using a magnetic bead method. The device includes a disc turntable, an arc arch bridge base, a supporting column, and a magnet structural unit and a sample reaction unit both arranged on the disc turntable. The disc turntable includes a top plate; the arc arch bridge base includes a bottom plate arranged at the lowermost portion and an arc supporting plate arranged on the bottom plate, and the arc supporting plate corresponds to the guide rod insertion holes in position in a radial direction of the disc, and the arc supporting plate includes raised regions used for jacking up a guide rod and a magnet and groove regions used for allowing the guide rod and the magnet to fall. The device provided by the present invention can realize the automatic nucleic acid extraction in a stream-lining manner.
US09896680B2	Compositions and methods comprising aspartyl-tRNA synthetases having non-canonical biological activities Isolated aspartyl-tRNA synthetase polypeptides and polynucleotides having non-canonical biological activities are provided, as well as compositions and methods related thereto.
US09896679B2	Fused NHase with improved specific activity and stability The present invention provides a fused NHase with improved specific activity and stability, which relates to the field of genetic engineering. This invention provides a method of overexpressing a fused NHase in E. coli and producing a mutant NHase with improved stability and product tolerance. The invention provides a simple, efficient and safe method of making mutant NHase, and can produce a large amount of soluble NHases in a short period. The present invention makes a contribution to large-scale industrial production and further theoretical study of NHases.
US09896673B2	Compositions of high stability alpha amylase variants The present invention relates to variants of an alpha-amylase having improved stability to chelating agents relative to its parent enzyme, compositions comprising the variants, nucleic acids encoding the variants, methods of producing the variants, and methods for using the variants.
US09896663B2	Leukaemia stem cell line, its method of production and uses thereof Bromodomain and extra terminal protein (BET) resistant leukemic cell lines and methods for producing such cell lines are described as are methods for using such cell lines in screening assays to identify therapeutic agents. The cell lines can be generated from haematopoietic stem and progenitor cells (HSPCs) that are clonally enriched by serially exposing c-kit positive cells to a BET inhibitor.
US09896659B2	Methods, kits, and compositions for stem cell self-renewal Methods and kits for expanding a stem cell population, particularly a hematopoietic stem cell population, in the presence of a DNA methyltransferase modulator and a Wnt pathway modulator are disclosed.
US09896651B1	Antiseptic and fragrance-free soap The antiseptic and fragrance-free soap includes about 5% to 30% percent by weight of deionized water, about 3% to 10% by weight of caustic soda, about 25% to 90% by weight of vegetable fat, and about 0.1% to 1% by weight of antibacterial nanoparticles. The vegetable fat can be selected from the group consisting of olive oil, coconut oil, palm oil, almond oil, jojoba oil, shea butter, or a combination thereof. The antibacterial nanoparticles are preferably silver nanoparticles made by any conventional method.
US09896641B2	Conveyor lubricants including emulsions and methods employing them The present disclosure relates to conveyor lubricant compositions including an emulsion. The present disclosure also relates to methods of employing such lubricant compositions. In an embodiment, the methods include applying the present lubricant composition to a conveyor with a non-energized nozzle. In an embodiment, the methods include applying the present lubricant composition in a “semi-dry” mode.
US09896639B2	Lubricant for marine engine The present disclosure relates to a lubricant for marine engines including at least one base oil, at least one overbased detergent, at least one neutral detergent and at least one fatty amine.
US09896627B2	Processes and systems for fluidized catalytic cracking Methods and systems for cracking a light fuel fraction and a heavy fuel fraction by fluidized catalytic cracking are described herein. The method for cracking may include feeding the light fuel fraction and a catalyst from a catalyst regenerator into a first reactor, cracking the light fuel fraction in the first reactor to produce an at least partially cracked light fuel fraction, transporting the at least partially cracked light fuel fraction and the catalyst from the first reactor to a second reactor, feeding the heavy fuel fraction into the second reactor, cracking the heavy fuel fraction and the at least partially cracked light fuel fraction in the second reactor to produce at least a product fuel and a spent catalyst, and transporting the spent catalyst to the catalyst regenerator and regenerating the catalyst in the catalyst regenerator.
US09896622B2	Coumarin-based derivative compound, preparing method thereof, and fluorescent composition containing the same Disclosed herein are a coumarin-based derivative compound, a preparation method thereof, and a fluorescent composition containing the same.
US09896620B2	Proppant sand coating for dust reduction The present invention provides for coating proppants, such as sand, with a resin-containing dispersion which dramatically reduces the dust generated during handling, for example in hydraulic fracturing, by protecting the surface of the particle from abrasion and degradation. Such resin-containing dispersion coated-sand may also reduce the wear on metal parts used in transporting such proppants.
US09896612B2	Methods for controlling lost circulation in a subterranean well and materials there for Method for controlling lost circulation in a subterranean well using oil-dispersible lost-circulation materials which comprise fibers that are coated (or sized) with a lipophilic coupling agent, a lipophilic film-forming polymer or both. The fibers are preferably between about 6 mm and about 25 mm long, and between about 10 μm and about 200 μm in diameter. The fibers may be added to carrier fluids comprising oil-base fluids, synthetic-base fluids, invert-emulsion-base fluids and combinations thereof. The preferred fiber concentration in the carrier fluid is between about 0.55 g/L and about 28.5 g/L. The carrier fluid may be a drilling fluid, a spacer fluid or a lost-circulation pill.
US09896610B2	Methods and aqueous based wellbore fluids for reducing wellbore fluid loss and filtrate loss Embodiments disclosed herein relate to aqueous based wellbore fluids for preventing wellbore fluid loss downhole containing at least one copolymer formed from at least one natural polymer monomer and at least one latex monomer, and an aqueous base fluid.
US09896608B2	Biobased pre-polymers and uses thereof for preparing polymers which are of use as additives in a poly(lactic acid) matrix The present invention relates to the use of a compound having the following formula (I): in which: A1 represents a divalent alkylene radical comprising from 2 to 20 carbon atoms; A2 represents a divalent alkylene radical comprising from 2 to 20 carbon atoms; A3 is selected from the group consisting of the following divalent radicals: an alkylene comprising from 2 to 600; and an arylene comprising from 6 to 30 carbon atoms; X1, X3 and X4 represent —O— or —NH—; X′2 is selected from the group consisting of: —S—, —CH2— and a bond; and n and m represent an integer ranging from 1 to 1000; for the preparation of additives in a matrix of polyester, polyvinyl chloride, polyurethane, polyamide, poly(alkyl acrylate), poly(alkyl methacrylate), polystyrene or polyolefin.
US09896606B2	Pressure-sensitive adhesive sheet and use thereof A PSA sheet is provided, having an adhesive face formed of an acrylic PSA layer comprising an acrylic polymer. The PSA sheet has a peel strength of 5 N/10 mm or greater. The peel strength is measured as such that the adhesive face is directly adhered to an ethylene-propylene-diene rubber surface and after 20 minutes, peeled in the 180° direction at a tensile speed of 50 mm/min.
US09896601B2	Dirt pick-up resistant silicone compositions Silicone compositions and methods of using the compositions are provided. The silicone coatings can exhibit improved dirt pick-up resistance and cleanability. The silicone compositions include a polysiloxane, an ultraviolet absorber, and optionally one or more of a pigment, a filler, a crosslinker, an adhesion promoter, a catalyst, additives or solvents.
US09896596B2	Plastic film Disclosed is a plastic film exhibiting excellent physical properties including a high level of hardness, high scratch resistance, and low reflection. Exhibiting a high level of hardness, scratch resistance, impact resistance, low reflectivity, and high transparency, the plastic film can be used as a substitute for a cover plate made of glass or reinforced glass.
US09896594B2	Cross-linking mechanism for thin organic coatings based on the Hantzsch di-hydropyridine synthesis reaction Disclosed is cross-linking process for cross-linking polymeric chains in a coating composition. In one embodiment the process utilizes a Hantzsch dihydropyridine reaction to form reaction products including cross-linking polymeric resin chains having beta-keto ester functions using a source of aldehyde and a source of ammonia or a primary amine to form a permanent dihydropyridine bond between the beta-keto ester functions. The novel cross-linking reaction can occur at lower temperatures compared to typical cross-linking reactions and can occur in aqueous solutions that have a neutral to mildly alkaline pH of from 6 to 11. The novel cross-linking reaction provides many advantages to performing cross-linking of polymeric chains in coating resins.
US09896568B2	Rubber compounds containing silicon dioxide for the production of tyres A method for preparing a rubber compound comprising at least one first mixing step in which at least part of a cross-linkable polymer base is mixed at least with a reactive reinforcing filler, a dendrimer functionalized with polar groups adapted to interact with the reactive reinforcing filler and a nucleophile agent; and a subsequent mixing step in which the compound being prepared is mixed with a vulcanization system.
US09896562B2	Networks and method for producing the same An embodiment of this invention discloses a method for producing a network texture and the method comprises the steps of: formation of a porous structure as a template (matrix); formation of two coherent, independent, and separated robust continuous network structures within the matrix by using the matrix as the template; softening or removing the matrix to shift the two continuous network structures, leading to a novel network texture comprising two incoherent continuous network structures.
US09896561B2	Dendritic macroporous hydrogels prepared by crystal templating The present invention includes a hydrogel and a method of making a porous hydrogel by preparing an aqueous mixture of an uncrosslinked polymer and a crystallizable molecule; casting the mixture into a vessel; allowing the cast mixture to dry to form an amorphous hydrogel film; seeding the cast mixture with a seed crystal of the crystallizable molecule; growing the crystallizable molecule into a crystal structure within the uncrosslinked polymer; crosslinking the polymer around the crystal structure under conditions in which the crystal structure within the crosslinked polymer is maintained; and dissolving the crystals within the crosslinked polymer to form the porous hydrogel.
US09896559B2	Phenolic foam Phenolic closed-cell foam comprises a hydrocarbon blowing agent and includes an alkali metal silicate in an amount of at least 1% by weight. The foam has an aged thermal conductivity as determined by the procedures of EN13166:2008 of less than 0.025 W/m·K. The foam is formed from a phenolic resole resin mixture having a water content of greater than 15% by weight but less than 24% by weight.
US09896552B2	Method for producing rubber wet master batch In the step (I), the period (minute(s)) for dispersing the carbon black species A showing a nitrogen adsorption specific surface area (N2SA-(A)value) of 130 m2/g or less in the dispersing solvent and that minute(s)) for dispersing the carbon black species B showing an N2SA-(B) value lower than the N2SA-(A) value by 25 m2/g or more in the dispersing solvent by α(A) and α(B), respectively, and further representing the rotation number (rpm) of a rotor of a dispersing machine used in the dispersing when the carbon black species A is dispersed, and that (rpm) of a rotor of a dispersing machine used in the dispersing when the carbon black species B is dispersed by β(A) and β(B), respectively, the following expression is satisfied: 1.1α(B)×β(B)≦α(A)×β(A)≦1.5α(B)×β(B) (1).
US09896551B2	Phosphaphenanthrene-based compound and related preparation method and application Provided is a phosphaphenanthrene-based compound represented by the following chemical structure: The phosphaphenanthrene-based compound can be added in a resin composition and made into a prepreg or resin film. The prepreg or resin film made from such resin composition has low coefficient of thermal expansion, low dielectric constant and dissipation factor, and flame retardancy, thereby being suitable for copper-clad laminate or printed circuit board.
US09896538B2	Polyfluoreno[4,5-cde]oxepine polymers and conjugates thereof The invention provides for polyfluoreno[4,5-cde]oxepine conjugates and their use in methods of analyte detection.
US09896533B2	Non-ionic associative thickeners containing cyclohexylol alkyls, formulations containing them and their uses The present invention concerns new associative thickeners of the HEUR type (Hydrophobically modified Ethylene oxide URethane) whose hydrophobic monomer is based on alkyl cyclohexylols. These are new polyurethanes that significantly thicken an aqueous formulation with a low, medium and high shear gradient. The invention also concerns the compositions containing them and their uses in different formulations such as aqueous paints.
US09896530B2	Copolymer, coloring material dispersion, ink, and ink store container A copolymer including a structural unit represented by General Formula (1) below and a structural unit represented by General Formula (2) below, where, in General Formula (1), R is a hydrogen atom or a methyl group and X is a hydrogen atom or a cation, where, in General Formula (2), L is an alkylene group having 2 or more but 18 or less carbon atoms.
US09896527B2	Highly selective polynorbornene homopolymer membranes for natural gas upgrading Embodiments for a crosslinked alkoxysilyl polynorbornene homopolymer and methods of making crosslinked alkoxysilyl polynorbornene homopolymer are provided, where the method comprises polymerizing through addition polymerization or ring opening metathesis polymerization a norbornene monomer comprising an alkoxysilyl moiety in the presence of a catalyst to produce an alkoxysilyl modified polynorbornene homopolymer, and producing a crosslinked alkoxysilyl polynorbornene homopolymer through sol-gel initiated crosslinking of the alkoxysilyl modified polynorbornene homopolymer at ambient conditions, or acid-catalyzed conditions.
US09896524B2	Low emission propylene homopolymer Propylene homopolymer with reduced emission value.
US09896521B2	Crosslinker-accelerator system for polyacrylates Crosslinker-accelerator system for the thermal crosslinking of polyacrylates having functional groups capable of entering into linking reactions with epoxide groups, comprising at least one substance having at least one epoxide group as crosslinker and at least one substance of the formula R12N—CR2R3—CR4R5—(CR6R7)n—X in which the R1 independently represent hydrogen, a substituted or unsubstituted alkyl or cycloalkyl radical or together with the nitrogen atom form a 5-7-membered ring; R2, R3, R4, R5, R6 and R7 independently represent hydrogen or an alkyl radical having 1 to 8 carbon atoms or form a 5-7-membered cycloalkylene group; n is an integer from 0 to 4; and X represents —OH, —OR, —SH, —SR and —PR2, in which R independently represents C1-C18 alkyl radical, C2-C18 alkenyl radical or C2-C18 alkynyl radical, an aryl group or an aliphatic or aromatic heterocycle, as accelerator.
US09896514B2	Clostridium difficile antigens The present invention relates to recombinant Clostridium difficile antigens based on a polypeptide, consisting of or comprising an amino acid sequence having at least 80% sequence identity with an amino acid sequence consisting of residues 1500-700 of a C. difficile Toxin A sequence or a C. difficile Toxin B sequence; though with the proviso that the polypeptide does not include one or more Repeat Unit (RU) located between amino acid residues 1851-2710 of C. difficile Toxin A and/or residues 1853-2366 of a C. difficile Toxin B protein that consists of or comprises a first amino acid sequence and a second amino acid. Also provided is the use of said antigens for the prevention/treatment/suppression of Clostridium difficile infection (CDI), together with methods for generating said antigens, methods for generating antibodies that bind to said antigens, and the use of said antibodies for the prevention/treatment/suppression of CDI.
US09896506B2	Anti-CD79B antibodies and immunoconjugates and methods of use The present invention is directed to compositions of matter useful for the treatment of hematopoietic tumor in mammals, including immunoconjugates comprising anti-CD79b cysteine-engineered antibody huMA79b.v28, and to methods of using those compositions of matter for the same.
US09896503B2	Antigen associated with the neovasculature of tumour metastases The invention relates to a binding member that binds the Extra Domain-A (ED-A) isoform of fibronectin for the treatment of tumour metastases.
US09896500B2	Antibody capable of binding to influenza virus The present invention provides a novel antibody capable of binding influenza virus. The antibody directed to the present invention consists of an amino acid sequence, wherein said amino acid sequence consists of, in an N- to C-direction, the following structural domains: N-FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4-C FR denotes a framework region amino acid sequence and CDR denotes a complementary determining region amino acid sequence; the CDR1 consists of an amino acid sequence represented by SYYMS (SEQ ID NO: 01) the CDR2 consists of an amino acid sequence represented by TINTGGGSTYYADSVKG (SEQ ID NO: 02); the CDR3 consists of an amino acid sequence represented by DGPYGGYDY (SEQ ID NO: 03); and the antibody is capable of binding to H12N1 influenza virus. Desirably, the FR1-FR4 consist of amino acid sequences represented by EVQLVESGGGLVQPGGSLRVSCAASGFTFS (SEQ ID NO: 04), WVRQAPGKGLEWVS (SEQ ID NO: 05), RFTISRDNAKNTLYLQMDSLKSEDTAVYYCAK (SEQ ID NO: 06), and WGQGTQVTVSP (SEQ ID NO: 07), respectively.
US09896498B2	Tumor vascular disrupting agent polypeptide, gene, expression vector, and use thereof The present invention relates to a tumor vascular disrupting agent polypeptide, gene, expression vector, and use thereof. The tumor vascular disrupting agent polypeptide has the amino acid sequence as shown by SEQ ID NO: 1. The polypeptide comprises a truncated tissue factor (tTF) and a tumor-targeting molecule (pHLIP); the factor and the molecule are connected by 5 amino acids, thereby ensuring the function of each not being affected by the other; the fusion protein can be positioned to the surface of a tumor vascular endothelial cell by means of the pHLIP, and provides the blood coagulation feature of the tTF in a tumor vessel and forms a thrombus, thereby disrupting the blood supply to the tumor area and treating tumor. The polypeptide of the present invention is significant to the treatment of tumor, and can be used in medicines for treating tumors.
US09896497B2	Toll-like receptor 2 binding epitope and binding member thereto The present invention relates to the identification of a TLR2 binding epitope wherein binding of a binding member to the epitope serves to inhibit TLR2 activation and/or signalling. Polypeptide fragments of TLR2 and three-dimensional structures comprising one or more amino acid residues His318, Pro320, Gln321 or Arg321, Tyr323, Lys347, Phe349, Leu371, Glu375, Tyr376 and His398 of TLR2 which define the identified epitope are provided for use in generating binding members. Also provided are binding members which bind to the identified epitope and methods of using same for the treatment and/or prevention of conditions associated with TLR2 activation and/or signalling.
US09896491B2	Composition for treatment of multiple sclerosis Novel oligopeptides, combinations thereof and fusion proteins composed of the above-mentioned oligopeptides are disclosed. Oligopeptides are homologous in amino acid sequence to the selected parts of the amino acid sequence of human myelin basic protein (MBP) and are capable to ameliorate the progression of multiple sclerosis by means of binding to and inactivation of epitope-specific anti MBP catalytic auto antibodies (ESAMBPCAA) involved into binding and catalytic degradation of MBP in course of progression of Multiple Sclerosis.
US09896488B2	Protamine in treatment of neuronal injuries The present invention relates to treatment of neuronal injury. The present invention discloses a novel use of an agent and a novel method for promoting neurite out growth and/or neural regeneration in CNS injuries. A novel mechanism of promoting neurite outgrowth by increasing the interaction of chondroitin sulphate proteoglycan (CSPG) to receptor protein tyrosine phosphatase sigma (RPTPσ) is disclosed.
US09896486B2	Mutated immunoglobulin-binding polypeptides A polypeptide with improved alkaline stability, which polypeptide comprises a mutant of a B or C domain of Staphylococcus Protein A, as specified by SEQ ID NO 1 or SEQ ID NO 2, or of Protein Z, as specified by SEQ ID NO 3, wherein at least the glutamine residue at position 9 has been mutated to an amino acid other than asparagine. The invention also discloses multimers of said polypeptide, as well as separation matrices comprising the multimers or polypeptides.
US09896484B2	Influenza virus recombinant proteins The present invention includes influenza Hemagglutinin protein fragments that fold properly when expressed in bacteria.
US09896483B2	Stabilized hepatitis B core polypeptides Genetically modified HBc polypeptides are provided.
US09896481B2	Modified mini-hepcidin peptides and methods of using thereof Disclosed herein are peptides which exhibit hepcidin activity and methods of making and using thereof.
US09896479B2	Functionalized naphthalene fluorophores Methods for the synthesis and use of functionalized, substituted naphthalenes are described. The functionalized, substituted naphthalenes display useful properties including liquid crystals and fluorescence properties, such as solvatochromatic fluorescence, with high quantum yields, Stoke's shift, and show emission maxima that are significantly red-shifted.
US09896474B2	(3A,9B,10A,13A,14B,17A,20S,22E)-ergosta-5,7,22-trien-3-ol and methods of preparing and using the same (3α,9β,10α,13α,14β,17α,20S,22E)-Ergosta-5,7,22-trien-3-ol. A method for preparing the same by drying a fruiting body of Cordyceps militaris, grinding the fruiting body to yield ultrafine powders; boiling and extracting the ultrafine powders, centrifuging and collecting a precipitate. A method for treating a tumor by administering to a patient in need of treating a tumor (3α,9β,10α,13α,14β,17α,20S,22E)-ergosta-5,7,22-trien-3-ol.
US09896469B2	Method for fractionating lignin The present invention relates to a method for fractionating lignin, wherein the method comprises the following steps: (i) dissolving lignin into a mixture containing organic solvent and water; and (ii) ultrafiltrating the mixture formed in step (i) through one or more filtration membranes for producing a predetermined number of lignin fractions, wherein each fraction contains lignin with a molecular weight within a predetermined range. The present invention further relates to a lignin fraction and to the uses thereof.
US09896468B2	Metal alkoxide compound, thin-film-forming material, method for producing thin film, and alcohol compound Disclosed is a metal alkoxide compound having physical properties suitable for a material for forming thin films by CVD, and particularly, a metal alkoxide compound having physical properties suitable for a material for forming metallic-copper thin films. A metal alkoxide compound is represented by general formula (I). A thin-film-forming material including the metal alkoxide compound is described as well. (In the formula, R1 represents a methyl group or an ethyl group, R2 represents a hydrogen atom or a methyl group, R3 represents a C1-3 linear or branched alkyl group, M represents a metal atom or a silicon atom, and n represents the valence of the metal atom or silicon atom.
US09896467B1	Organic compound with tetrahedral-like geometry An organic compound with a tetrahedral-like geometry is disclosed. The organic compound has a structure represented by formula (I): wherein A1 to A4 each independently represent a 5-membered or 6-membered unsaturated ring; B1 represents direct bonding, —C—, —O—, —N—, —S— or —C═C—; m is 0 or 1; each of Ra's is independently hydrogen, fluorine, oxygen, substituted or unsubstituted C1-C12 alkyl or substituted or unsubstituted C6-C12 aryl; and n is an integer of 0 to 2.
US09896462B1	Metal halide perovskites, methods, and devices Provided herein are metal halide perovskites that may have a 0D crystal structure, and may be lead free. Also provided are methods for making the metal halide perovskites, including methods for making bulk crystals or micro crystals. Devices, such as optoelectronic devices, also are provided that include one or more of the metal halide perovskites. A metal halide perovskite may be a light emitting material in the devices.
US09896455B2	Tricyclic compounds having cytostatic and/or cytotoxic activity and methods of use thereof The present invention provides tricyclic compounds having cytostatic and cytotoxic activity in a single molecule having receptor tyrosine kinase(s), dihydrofolate reductase, thymidylate synthase and/or dihydroorotate dehydrogenase inhibitory activity, which are useful as anti-angiogenic and anti-tumor agents. Also provided are methods of utilizing these inhibitors to treat tumor cells and other proliferative diseases and disorders.
US09896449B2	Ring-fused bicyclic pyridyl derivatives as FGFR4 inhibitors The present invention provides a compound of formula (I) or a pharmaceutically acceptable salt thereof; a method for manufacturing said compound, and its therapeutic uses. The present invention further provides a combination of pharmacologically active agents and a pharmaceutical composition comprising said compound.
US09896442B2	Antifungal treatment A method of treating or preventing fungal infection, which includes identifying a plant or animal having a fungal infection and administering an effective amount of an anti-fungal composition to the plant or animal to reduce the fungal infection. In a preferred form of the present invention, the antifungal composition is compound 13 or 33 and is combined with an azole compound, such as fluconazole.
US09896438B2	2,2,2-trifluoroethyl-thiadiazines The present invention provides a compound of formula (I) having BACE1 inhibitory activity, their manufacture, pharmaceutical compositions containing them and their use as therapeutically active substances. The active compounds of the present invention are useful in the therapeutic and/or prophylactic treatment of e.g. Alzheimer's disease.
US09896437B2	Diarylhydantoin compounds The present invention relates to diarylhydantoin compounds and methods for synthesizing them and using them in the treatment of hormone refractory prostate cancer.
US09896434B2	Substituted indanone compounds as GPR119 modulators for the treatment of diabetes, obesity, dyslipidemia and related disorders The present invention relates to indanone compounds. The indanone compounds are GPR119 modulators and useful for the prevention and/or treatment of diabetes, obesity, dyslipidemia and related disorders. The invention furthermore relates to the use of indanone compounds as active ingredients in pharmaceuticals, and pharmaceutical compositions comprising them.
US09896433B2	Antiviral compounds The present invention discloses compounds of Formula I wherein the variables in Formula I are defined as described herein. Also disclosed are pharmaceutical compositions containing such compounds and methods for using the compounds of Formula I in the prevention or treatment of HCV infection.
US09896425B2	Process for purifying an acid composition comprising 2-formyl-furan-5-carboxylic acid and 2,5-furandicarboxylic acid An acid composition comprising 2-formyl-furan-5-carboxylic acid and 2,5-furandicarboxylic acid is purified in a process which comprises; contacting the acid composition with an alcohol to obtain an esterified composition; and separating the ester of 2-formyl-furan-5-carboxylic acid from the esterified composition to obtain a purified esterified product; and contacting the purified esterified composition with water for saponification or hydrolysis, to obtain a product composition, comprising 2,5-furandicarboxylic acid and a reduced amount of 2-formyl-furan-5-carboxylic acid.
US09896423B2	Deuterium substituted 1-[2-(2,4-dimethyl-phenylsulfanyl)-phenyl]piperazine compound or derivatives thereof, and pharmaceutical composition and use thereof The present disclosure provides a deuterium substituted 1-[2-(2,4-dimethyl-phenylsulfanyl)-phenyl]piperazine compound with a structure represented by formula (I) or a derivative thereof, a pharmaceutical composition containing the compound or the derivative thereof, and an application of the compound or the derivative thereof in preparing drugs. The compound can reduce oxidative metabolism thereof, increase the drug concentration in blood and the effective bioavailability, so as to lower the dosage and reduce the toxicity and other side effects. The deuterium 1-[2-(2,4-dimethyl-phenylsulfanyl)-phenyl]piperazine compound and its derivative thereof provided by the present disclosure can be used to treat related diseases such as affective disorders, depression and anxiety.
US09896418B2	Aryl ethers and uses thereof The present disclosure relates to HIF-2α inhibitors and methods of making and using them for treating cancer. Certain compounds were potent in HIF-2α scintillation proximity assay, luciferase assay, and VEGF ELISA assay, and led to tumor size reduction and regression in 786-O xenograft bearing mice in vivo.
US09896416B2	Piperidinium quaternary salts There are described new 1-alkyl-1-methyl-4-[(2,2-diphenyl-2-propoxy)acetoxy]piperidinium halides and pharmaceutical compositions comprising a 1-alkyl-1-methyl-4-[(2,2-diphenyl-2-propoxy)acetoxy]piperidinium halide as an active ingredient. These products are non-selective muscarinic acetylcholine receptor antagonists acting in the periphery and not in the brain.
US09896411B2	Characterization of the cocrystal products formed by metoprolol and dabigatran bases with L-theanine Methods of making cocrystal compositions of metoprolol and dabigatran bases with enantiomers of theanine.
US09896400B2	Process for producing a chlorinated C3-6 alkane Disclosed is a process for producing a chlorinated C3-6 alkane comprising providing a reaction mixture comprising an alkene and carbon tetrachloride in a principal alkylation zone to produce chlorinated C3-6 alkane in the reaction mixture, and extracting a portion of the reaction mixture from the principal alkylation zone, wherein: a) the concentration of the chlorinated C3-6 alkane in the reaction mixture in the principal alkylation zone is maintained at a level such that the molar ratio of chlorinated C3-6 alkane:carbon tetrachloride in the reaction mixture extracted from the alkylation zone does not exceed 95:5 when the principal alkylation zone is in continuous operation; and/or b) the reaction mixture extracted from the principal alkylation zone additionally comprises alkene and the reaction mixture is subjected to a dealkenation step in which at least about 50% or more by weight of the alkene present in the reaction mixture is extracted therefrom and at least about 50% of the extracted alkene is fed back into the reaction mixture provided in the principal alkylation zone; and/or c) the reaction mixture present in the principal alkylation zone and extracted from the principal alkylation zone additionally comprises a catalyst, and the reaction mixture extracted from the principal alkylation zone is subjected to an aqueous treatment step in which the reaction mixture is contacted with an aqueous medium in an aqueous treatment zone, a biphasic mixture is formed and an organic phase comprising catalyst is extracted from the biphasic mixture.
US09896395B2	Process and system for making cyclopentadiene and/or dicyclopentadiene Processes and systems for making cyclopentadiene and/or dicyclopentadiene include converting acyclic C5 hydrocarbon(s) into CPD in a first reactor to obtain a product mixture, washing the product mixture with a wash oil, separating the washed product mixture in a separation sub-system such as compression train to obtain a C5-rich fraction comprising CPD, dimerizing the C5-rich fraction in a dimerization reactor to obtain a product effluent, followed by separating the product effluent to obtain a DCPD-rich fraction. Wash oil can be recovered and recycled. Multiple-stage of dimerization and separation steps can be used to obtain multiple DCPD-rich fractions of various purity and quantity. C5-rich fractions from various stages of the process may be recycled to the first reactor, or converted into mogas components after selective hydrogenation. C5-rich fractions and mogas components may be optionally separated to produce value-adding chemicals.
US09896393B2	Process for preparing dialkylbiphenyl isomer mixtures In a process for producing dialkylbiphenyl compounds, a feed comprising substituted cyclohexylbenzene isomers having the formula (I): wherein each of R1 and R2 is an alkyl group and wherein the feed comprises m % by weight of isomers in which R1 is in the 2-position, based on the total weight of substituted cyclohexylbenzene isomers in the feed; is transalkylated with a compound of formula (II): to produce a transalkylation product comprising substituted cyclohexylbenzene isomers having the formula (I) and including n % by weight of isomers in which R1 is in the 2-position, based on the total weight of substituted cyclohexylbenzene isomers in the transalkylation product, wherein n
US09896375B2	Colored glass A colored glass, a surface of which is roughened in whole or in part. In the colored glass, an average value of gloss values measured at 9 points in the surface thereof at an incident angle of 60° in accordance with JIS 28741 (1991) is 30 or less, a ratio of a difference between a maximum gloss value and a minimum gloss value to the maximum gloss value is 20% or less, and a minimum value of visible-light transmittance at a thickness of 0.8 mm is 70% or less.
US09896371B2	Tempered glass cutting method and cutting apparatus The present invention is devised to solve the problems of the above-described conventional technologies. The purpose of the present invention is to provide a tempered glass cutting method and cutting apparatus which can prevent the defects of the tempered glass breaking when same is cut and improve the reliability of the product. To this end, provided is a tempered glass cutting method which comprises: a tempering step of generating compressive stress on a glass sheet to temper the glass sheet; a compressive stress relaxation step of applying heat to the cut portion of the tempered glass sheet to relax the compressive stress; and a cutting step of cutting the cut portion.
US09896369B2	Glass sheet forming and annealing providing edge stress control Glass sheet forming and annealing disclosed provides control of edge stresses by maintaining a press formed glass sheet on an annealing ring (72) below a heated upper forming mold (58) within a forming station (12) for slow cooling toward the glass strain point temperature.
US09896366B2	Alternative additives to enhance slurry dewatering The invention provides methods and compositions for improving dewatering of mineral slurry. The method comprises adding an R-Succinic Compound (such as octadecenyl succinic acid, hexadecenyl succinic acid, and/or dodecenyl succinic acid) to the slurry. The R-Succinic Compound removes water that would otherwise be trapped within the filtered slurry cake.
US09896364B2	Synergistic interaction of weak cation exchange resin and magnesium oxide The present invention relates to methods, apparatuses, and systems for treating water. The methods, apparatuses and systems reduce scaling associated with solubilized water hardness using a sequence of water treatment agents, including an inlet, one or more treatment reservoirs containing a first treatment agent that is an exhausted ionic resin that is incapable of performing ion exchange and a second treatment agent consisting of a metal oxide and/or hydroxide compound, an outlet, and a treated water delivery line.
US09896363B2	Moving bed biofilm reactor for waste water treatment system In one embodiment, a method includes receiving wastewater having a first total organic carbon (TOC) at a wastewater treatment system comprising a reactor system, wherein the reactor system comprises an anaerobic moving bed biofilm reactor (MBBR) and an aerobic MBBR. The method further includes treating the wastewater in the anaerobic MBBR, wherein the anaerobic MBBR comprises first bio-carriers configured to degrade at least a portion of the first TOC in the wastewater to generate a first treated wastewater and biogas, wherein the first treated wastewater has a second TOC that is less than the first TOC. The method also includes providing the biogas to an external system.
US09896358B2	Method of treating cellulose containing waste water sludge for the manufacture of linerboard and cellulosic ethanol production The current process relates to the treatment of a primary sludge that is produced from waste water treatment facilities such as a pulp mill or a pulp and paper mills. It further relates to a process of using the primary sludge in the production of cellulosic ethanol. It further relates to the use of the treated primary sludge in the manufacture of recycled linerboard.
US09896345B2	Lithium manganese compounds and methods of making the same Electrode materials such as LixMnO2 where 0.2
US09896341B2	Methods of forming carbon nanotubes having a bimodal size distribution A composition comprising a mixture of carbon nanotubes having a bi-modal size distribution are produced by reducing carbon oxides with a reducing agent in the presence of a catalyst. The resulting mixture of nanotubes include a primary population of multiwall carbon nanotubes having characteristic diameters greater than 40 nanometers, and a secondary population of what are apparently single wall nanotubes with characteristic diameters of less than 30 nanometers. The resulting mixture may also contain one or more other allotropes and morphologies of carbon in various proportions. The mixture of carbon nanotubes has specific apparently uncommon properties, including unusual resistivity and density
US09896335B1	Multiple oxygen allotrope generator An oxygen allotrope generator having a tube with an electrically grounded outer surface and an electrically positive inner surface. A plurality of corona reaction plates are spaced along the interior of the tube, the plates being longitudinally inter-connected by wires and being in electrical connection with the electrically positive inner surface of the tube. An outer jacket encloses the tube and provides a second linear pass for partially ozonated gas to flow in the generator. An alternative embodiment includes external distributed ground connections at the locations of the corona reaction.
US09896331B2	Method for encapsulating a microelectronic device with a release hole of variable dimension Method for encapsulating a microelectronic device, comprising the following steps: producing a sacrificial portion covering the device; producing a cover covering the sacrificial portion, comprising two superimposed layers of separate materials and having different residual stresses and/or coefficients of thermal expansion; etching, through the cover, of a trench of which the pattern comprises a curve and/or two straight non-parallel segments; etching of the sacrificial portion through the trench; depositing a sealing material on the trench; in which, during the etching of the sacrificial portion, a portion of the cover defined by the trench deforms under the effect of a mechanical stress generated by the residual stresses and/or a thermal expansion of the layers of the cover and increases the dimensions of the trench, this stress being eliminated before the sealing of the trench.
US09896330B2	Structure and method for packaging stress-sensitive micro-electro-mechanical system stacked onto electronic circuit chip A packaged micro-electro-mechanical system (MEMS) device (100) comprises a circuitry chip (101) attached to the pad (110) of a substrate with leads (111), and a MEMS (150) vertically attached to the chip surface by a layer (140) of low modulus silicone compound. On the chip surface, the MEMS device is surrounded by a polyimide ring (130) with a surface phobic to silicone compounds. A dome-shaped glob (160) of cured low modulus silicone material covers the MEMS and the MEMS terminal bonding wire spans (180); the glob is restricted to the chip surface area inside the polyimide ring and has a surface non-adhesive to epoxy-based molding compounds. A package (190) of polymeric molding compound encapsulates the vertical assembly of the glob embedding the MEMS, the circuitry chip, and portions of the substrate; the molding compound is non-adhering to the glob surface yet adhering to all other surfaces.
US09896326B2	FCVD line bending resolution by deposition modulation A method of reducing line bending and surface roughness of a substrate with pillars includes forming a treated surface by treating a pillar-containing substrate with a radical. The radical may be silicon-based, nitrogen-based or oxygen-based. The method may include forming a dielectric film over the treated surface by reacting an organosilicon precursor and an oxygen precursor. The method may include curing the dielectric film at a temperature of about 150° C. or less. A method of reducing line bending and surface roughness of a substrate with pillars includes forming a dielectric film over a pillar-containing substrate by reacting an organosilicon precursor, an oxygen precursor, and a radical precursor. The method may include curing the dielectric film at a temperature of about 150° C. or less. The radical precursor may be selected from the group consisting of nitrogen-based radical precursor, oxygen-based radical precursor, and silicon-based radical precursor.
US09896320B2	System and method for storing and selectively dispensing liquids The inventive system and method advantageously enable superior preserved storage and selective dispensation of liquids by storing wine (or other liquids) in a pressurized environment to ensure that the stored liquid does not come into contact with air, and then by selectively dispensing a portion of the stored liquid, in accordance with a desired dispensing regime, by utilizing a controlled source of pressure force to apply a sufficient pressure to the pressurized environment to expel the desired volume of the liquid in a pressurized stream directed to a dispensing/pouring interface through a conduit or equivalent delivery system. In at least several novel embodiments thereof, the system and method of the present invention are configured for use with wine-in-bag (“WinB”) products.
US09896316B2	End effector for a transport device for the movement of parent rolls of convolutely wound web materials An end effector for a transport device for the movement of parent rolls of convolutely wound web materials is disclosed. The end effector comprises a frame, first and second radial members operably connected to the frame, a first core plug operably connected to the first longitudinal member, and a second core plug operably connected to the second longitudinal member. A first core plug extensible from a first position to a second position relative to the first longitudinal member and a second core plug extensible from a first position to a second position relative to the second longitudinal member are capable of cooperative and penetrating engagement with a core of the parent roll.
US09896306B2	Apparatus and method for dampening oscillations of an elevator car A method and apparatus for dampening oscillations of an elevator car retains the active control of an elevator system in the presence of displacement. This active control may be maintained via the use of an actuator that tailors Lorentz force relative to the level of displacement along a non-linear continuum.
US09896304B2	Security system for elevator A method of operating an elevator system includes presenting a credential at a security panel disposed at an elevator system landing of a public area of a building. If the presented credential is correct a contact between the security panel and an elevator control system is opened. Opening of the contact allows for placement of a call via the elevator control system for an elevator car to the landing. An elevator system includes one or more elevator cars located in one or more hoistways. An elevator control system controls movement of the elevator cars. A security panel is operably connected to the elevator control system and located at an elevator system landing. Presenting a correct credential at the security panel opens a contact between the security panel and the elevator control system thus initiating a call of an elevator car of the one or more elevator cars to the landing.
US09896288B2	Paper feed apparatus and image forming apparatus A paper feed apparatus includes a paper feeding roller and a separating pad for separating paper one by one and feeding the paper. This separating pad is supported by a separating pad holder to be abutted onto the paper feeding roller with a predetermined pressure. Furthermore, the separating pad holder is provided with a weight member in a loosely-fitted state.
US09896283B2	Article transport facility An article transport facility includes a support member capable of supporting a second support component from below while allowing a vertical movement of a first support component with respect to the second support component, in a projected state in which the second support component is located in a projected position. The support member is supported directly or indirectly by a ceiling.
US09896282B2	Pedestrian-vehicle warning systems for loading docks Example safety systems for use at a loading dock are disclosed. An example safety system includes a sensor installed at the loading dock. The sensor provides a feedback signal in response to sensing the vehicle. An alarm device is mounted below a lowest elevation of the doorway. The alarm device is positioned between the first lateral plane and the second lateral plane of the doorway. An alarm signal is emitted by the alarm device in response to the feedback signal.
US09896267B2	Cargo handling apparatus and method According to one embodiment, a cargo handling apparatus includes a first mechanism, a second mechanism, a holding unit, a third mechanism, a fourth mechanism and a conveyor. The first mechanism is movable in a first direction. The second mechanism is connected to the first mechanism and is movable on a first horizontal plane intersecting the first direction. The holding unit is connected to the second mechanism and holds an object to be picked up. The third mechanism is arranged below the first mechanism, the second mechanism and the holding unit, and is movable in the first direction. The fourth mechanism is connected to the third mechanism and is movable on a second horizontal plane opposed to the first horizontal plane. The conveyor is connected to the fourth mechanism, and loads and conveys the object held by the holding unit.
US09896263B2	Collapsible containers A collapsible shipping container has a corner post located at each corner of a base frame. A respective stile of an end cover frame, which may support at least one door, is pivotally mounted on the base frame adjacent each corner post. Respective lifting members on each corner post and stile have curved abutment faces which engage when the stile is in the erected position, and a latch member releasably locks the stile in the erected position.The or each end cover frame may be provided with a spring—or winch system to assist in moving the end cover frame to the erected position.
US09896262B2	Storage box using cushion package structure A cushion package structure includes at least a plate and two or more blocks. The plate is disposed within a storage box and the blocks are the same and pivotable with one another. As a number of blocks are connected with one another serially with various including angle between each adjacent two, one or multiple block sets may be formed thereby. Positioning holes on the plate having substantially same contour as corresponding positioning sections on the blocks are further prepared to engage with the positioning sections as the block sets are put to be disposed on the plate, thereby forming a storage space with a specific shape within the storage box. The blocks may be removed from the plate, rearranged, and redisposed on another plate, so that a storage space with a different shape may be defined.
US09896258B2	Device having accommodation portion open via main body for accommodating dissimilar materials Provided is an accommodating device for accommodating a different type of material and opening an accommodating part via a main body. The accommodating part, which is sealed, is disposed around a container spout part and coupled to the container spout part in a discharge direction of a material contained in the container and includes a storage space having a separate storage function. While the main body is disposed around the container spout part coupled to the accommodating part and is coupled to the container spout part, the storage space disposed in the accommodating part is opened to perform a dropping and mixing process in a storage space disposed in the container.
US09896257B2	Lid for a beverage cup including a snack storage reservoir A lid for a beverage cup includes: (a) a radial collar configured to engage with a rim of a drinking cup mouth, having an inner radial surface and an outer radial surface; (b) an outer reservoir wall extending axially upward from the outer surface of the radial collar and enclosing a reservoir chamber above the radial collar, and including an upper rim; (c) a reservoir floor extending radially inward from an upper end of the inner surface of the radial collar and substantially closing the reservoir chamber from below the reservoir floor, the floor including a fluid path opening providing at least part of a fluid path extending upward through the reservoir chamber, the fluid path opening being positioned along a first diametrical line extending through the reservoir chamber; (d) an inner wall separating the fluid path from the reservoir chamber substantially in the shape of an upside-down funnel extending upward from the floor, having a minor diameter extending above a vertical level of the upper rim of the outer reservoir wall to form a spout; and (e) a cap connected to the upper rim of the outer wall with a first living hinge and including a first segment with a hole adapted to receive the spout.
US09896253B2	Flexible containers with reinforcing seals Flexible containers having inflated structures and reinforcing seals.
US09896252B2	Cable tie A cable tie having a desired length of flexible belt and a buckle connected to one longitudinal end of the belt may include rack teeth that are formed in one surface of the belt and are arranged in a longitudinal direction of the belt, an engagement strip that is positioned in a through hole of the buckle and is configured to be deformed about its proximal end connected to an inner wall of the buckle, and an engagement claw that is formed in the engagement strip. The engagement strip is configured to be deformed due to contact with the belt inserted into the through hole of the buckle, so that a crossing angle is formed between the engagement surface of the engagement claw and the tooth surface of one of the rack teeth in a fastened condition in which the belt is inserted into the through hole of the buckle and is tightened.
US09896251B2	Sealing cap for a cleaning agent container The invention relates to a sealing cap (10) for cleaning agent containers (1), comprising a cup-shaped cap body (11) and a brush device, wherein the cap body (11) has a cap base (13) on a closed end (18), and a cover surface (14) that extends from the cap base (13) to an open end (15) of the cap body (11). The invention is characterized in that the brush device is formed as a brush attachment (12) having a ring (25) and a base plate (24), wherein the ring (25) can be attached to the closed end (18) of the cap body using the base plate (24), and having at least one air opening (27, 35) suitable for permitting an equalization of the pressure when attaching the brush attachment (12) to the closed end (18) of the cap body (11).
US09896244B2	Linkable workstations Linkable workstations are provided that define a reservoir for containing liquid. The linkable workstations can be nested together in a compact vertical space. The workstations include a plurality of high rim portions and a plurality of low rim portions. The high rim portions on a workstation are configured to overlap a low rim portion of another workstation to link workstations side to side to form custom configurations. The workstations include overflow channels that allow for the sharing of the liquid containing capacity between linked workstations, and which can be selectively sealed to prevent fluid from flowing therethrough.
US09896243B2	Liquid stopper and electronic cigarette using same A liquid stopper for an electronic cigarette, includes a main body configured for stopping a tobacco liquid of the electronic cigarette. The main body includes a bottom surface, at least one wire hole in communication with the bottom surface, and at least one wire groove formed in the bottom surface and in communication with the at least one wire hole. The at least one wire hole is configured to receive at least one conductive wire of the electronic cigarette, and the at least one wire groove is configured to guide the at least one conductive wire to a peripheral wall of the main body. An electronic cigarette using the liquid stopper is also provided.
US09896242B2	Multipurpose dispenser for spreadable wall repair compound A container for dispensing a flowable material includes a body member having a neck portion containing an opening for dispensing the flowable material, a collapsible mid portion adjacent the neck portion, and a non-collapsible tail portion adjacent the mid portion that serves as a blade for smoothing the flowable material after the flowable material has been dispensed from the container. Also disclosed is such a container having a cap and an abrasive assembly including a lid and an abrasive element for sanding the hardened material.
US09896239B2	Container with synthetic resin window, preform, and preform injection molding apparatus An injection molded test-tube-shaped preform, which is subjected to biaxial stretch blow molding, includes a circumferential wall including a longitudinal strip-shaped portion that is made of a transparent or a semi-transparent B resin and that is formed in a longitudinal strip shape penetrating the circumferential wall in a circumferentially predetermined position in the circumferential wall over a predetermined height range. A remaining portion of the circumferential wall excluding the longitudinal strip-shaped portion is made of an A resin that is obtained by coloring a synthetic resin. A portion of the B resin constituting the longitudinal strip-shaped portion flows around an opposite side to the circumferentially predetermined position in which the longitudinal strip-shaped portion is formed, to be laminated in the vicinity of a portion of the circumferential wall made of the A resin that is close to an inner circumferential surface of the circumferential wall.
US09896233B2	Rectangular container having a vertically extending groove A blow molded plastic container is provided. The container has a body section having a substantially non-circular cross-sectional shape, the body section having an enclosed bottom portion that forms a bottom end of the container and substantially flat side portions extending upwardly from the bottom end; a finish defining an opening; and a dome extending from the body section to the finish. The dome includes at least one stiffening structure formed by an inwardly indented, vertically extending groove.
US09896230B2	Pet bottle sterilization apparatus and sterilization method A PET bottle sterilization method for consecutively sterilizing multiple PET bottles (B) while conveying them, includes introducing hydrogen peroxide into a PET bottle (B) so as to sterilize its interior, and introducing hot air into the sterilized PET bottle (B) so as to eliminate hydrogen peroxide remaining inside it. This method includes introducing plasma into a PET bottle (B) by injecting plasma through a nozzle at at least one time point among a time point before hydrogen peroxide is introduced into the PET bottle (B), a time point after hydrogen peroxide was introduced into the PET bottle (B) and furthermore before hot air is introduced into the PET bottle (B), and a time point after hot air was introduced into the PET bottle (B).
US09896227B2	Beverage bottle with a resealable storage compartment A combination container for a consumer product consisting of a body providing a primary compartment for containing a primary product, the body having a sidewall, a secondary compartment forming a cavity recessed into the body, one or more secondary products pre-packaged in a secondary product package being located within the cavity of the secondary compartment and a label over the secondary product package.
US09896226B2	Mail piece insertion mechanisms and methods of use A mail piece insertion mechanism is provided and, more particularly, mail piece insertion mechanisms and methods used for inserting mail pieces such as, for example, residual mail, into individual mail piece folders or containers is provided. The method of inserting mail pieces into folders includes opening the folders and aligning a mechanism with the opened folders and inserting the mail pieces therein. The insertion mechanism includes a mechanism configured open folders and a mechanism configured to insert mail pieces into the open folders.
US09896211B2	Control device, lighting system, mobile object The control device individually controls operations of the two or more lighting devices. Each lighting device includes a light source, a sensor for measuring light intensity of the light source, and a controller circuit for controlling the light source. The control device includes a replacement detector circuit, and the replacement detector circuit determines whether any of the lighting devices has been replaced, and obtains a determination result distinguishing a replacement lighting device from remaining lighting device(s). When the replacement detector circuit has obtained the determination result, the control device controls at least one of the lighting devices based on the measurement value outputted from the sensor of the replacement lighting device and the measurement value(s) outputted from the sensor(s) of the remaining lighting device(s), so that a difference between light intensity of the replacement lighting device and light intensity derived from the remaining lighting device(s) falls within a predetermined range.
US09896206B2	Supply packs and methods and systems for manufacturing supply packs A cost-effective pack adapted to be distributed from an aircraft in the event of a natural, military, political, or other disaster includes an outer package, at least one item in the outer package for aerial delivery, and at least one aerodynamic component formed on the outer package and methods and systems for making the pack.
US09896202B2	Systems and methods for reliable relative navigation and autonomous following between unmanned aerial vehicle and a target object A method for navigating an airborne device relative to a target comprises detecting, at an optical detector on the airborne device, an optical signal generated by one or more LEDs on the target. The method also comprises comparing, by a processor on the airborne device, the detected optical signal with a previously-detected optical signal. The method further comprises determining, by the processor based on the comparison, a change in location of at least one of the airborne device or the target. The method also comprises adjusting a position of the airborne device based on the determined change in location. The method also comprises predicting, by the processor, a movement of the target based on information indicative of at least one of a position, a rotation, an orientation, an acceleration, a velocity, or an altitude of the target, wherein the position of the airborne device is adjusted based on the predicted movement of the target. The method also comprises detecting an obstacle in a flight path associated with the airborne device and adjusting a position of the airborne device is further based, at least in part, on detected obstacle information.
US09896191B2	Fluid-vectoring system A jet aircraft includes an aircraft integrated, fluid vectoring, exhaust nozzle system. Implementation of this disclosure may eliminate or reduce the size of the aircraft vertical stabilizer and rudder assembly, thereby potentially improving aircraft survivability and increasing aircraft thrust-to-weight ratio.
US09896187B2	Connector between two aircraft components, such as a wing and wing tip device An aircraft structure comprising a wing tip device connected to a wing by a plurality of connectors, wherein each connector comprises a spigot associated with the wing tip device or the wing, and a lug associated with the other of the wing tip device or wing. The lug has a hole for receiving the respective spigot. The spigot of each connector is moveably mounted, relative to said wing tip device or wing, about a central position, such that during movement of the connectors from a dis-engaged configuration to an engaged configuration, each spigot can move away from the central position to align itself with the hole of the respective lug.
US09896183B2	Airframe component with electrically bonded connections An airframe component is provided and includes first and second components having respective first and second opposite surfaces and edge portions, the first component defining a plane and the second component being attachable to the first surface of the first component as a protrusion from the plane, a first conductive layer disposed to wrap around the edge portion of the first component from the first surface to the second surface, a second conductive layer disposed on the first surface of the second component to extend beyond the edge portion and an insulation layer interposable between the first and second conductive layers and between a periphery of the first surface of the second component and the second conductive layer.
US09896180B2	Method for manufacturing a load bearing structure and such a load bearing structure A method for manufacturing a load bearing structure involves providing a panel; providing a first set of split stiffening elements on a surface of the panel, wherein the split stiffening elements of the first set have bottom surfaces and central portions with open top clearances, respectively, spaced apart from each other; providing a second set of stiffening elements having bottom surfaces and top surfaces and central portions, respectively; inserting the stiffening elements of the second set into respective open top clearances of the split stiffening elements of the first set and providing the second set of stiffening elements on the surface of the panel for forming a grate structure; and attaching top surfaces to the split stiffening elements of the first set for forming complete profiles.
US09896173B2	Adjustable jack plate and trim and tilt system for a marine vessel An apparatus for adjusting positions of an outboard propulsion unit of a marine vessel comprises a jack plate having a jack plate actuator capable of moving the propulsion unit between raised and lowered positions and a swivel bracket having a swivel bracket actuator capable of pivoting the propulsion unit between raised and lowered trim positions. There is a control system operatively connected to the jack plate actuator and the swivel bracket actuator. The control system includes a first manual control which incrementally moves the jack plate an incremental amount each time the first manual control is actuated and a second manual control which incrementally pivots the swivel bracket an incremental amount each time the second manual control is actuated. Movement of the propulsion unit within a tilt range may be detected and the jack plate may be moved to a preset position.
US09896171B2	Shoe binding system for a rowing boat The invention relates to a system (1) for binding a shoe (2) to a foot rest (3) of a rowing boat, said shoe (2) having a sole (21) and said foot rest (3) being likeable to a plate having an underside (9) and a top surface (8). The main feature of a binding system according to the invention is that it comprises at least one mobile stop (6) projecting from the top surface (8) and a rigid actuating lever (4) projecting from the underside (9), and in that said lever (4) is connected to said at least one stop (6) in such a way that movement of said lever (4) causes said at least one stop (6) to move between a deployed position in which it becomes lodged in a recess (22) in the sole (21), and a retracted position in which it leaves said recess (22) and allows the shoe (2) to be detached from the foot rest (3).
US09896169B2	Landing watercraft boat hull with push knees and side bumper assemblies A landing watercraft boat hull with push knees and side bumper assemblies that include a vertical rigid frame aligned parallel to the hull's longitudinal axis. The rigid frame's front edge extends in front of the bow of the hull. Attached to the rigid frame's top edge and extending over the rigid frame's front edge is an L-shaped front bumper. In one embodiment there are two assemblies located on opposite sides of a landing door. The rigid frames are sufficient in length so the front edges of the two L-shaped bumpers are disposed in front of the bow enabling the hull to safely push against other hulls or objects and protect the landing door. Attached to the outside surface of each rigid frame is a rigid shell cover that extends rearward from the rigid frame. The cover includes a rear opening in which the distal end of a side bumper attached to the side of the hull is inserted to hold and protect the distal end of the side bumper.
US09896167B2	Subsea wellbore operations vessel A vessel (1) adapted to perform subsea wellbore related operations involving a riser string between the subsea wellbore and the vessel, e.g. drilling and/or wellbore intervention. The vessel (1) has a hull (2) and a riser storage (40) adapted to store therein of multiple risers in horizontal orientation. The riser storage (40) is adapted to store therein, or has stored therein, multiple pre-assembled riser stands (60), e.g. at least 25 riser stands, each riser stand being assembled from multiple riser sections (60, 61) connected end-to-end, e.g. each riser stand (62) consisting of two riser sections (60, 61), each riser section comprising a riser pipe and optionally one or more satellite pipes on the outside of and along the riser pipe, each riser section (60, 61) comprising a connector fitting arrangement at each end thereof, and each riser section (60, 61) comprising preferably one or more buoyancy members, wherein in a riser stand the connector fitting arrangement of one riser section is connected to a connector fitting arrangement of another riser section.
US09896162B2	Submersible vessel having retractable wing and keel assemblies A submersible vessel having wing and keel assemblies that are extendable for wind-powered surface operation and retractable to reduce drag for submerged operation or to place the vessel in a more compact configuration. A deployment mechanism including an actuator and linkage pivots the wing and keel assemblies simultaneously between the deployed and retracted configuration. The vessel may have first and second pressure hulls flanking the wing and keel assemblies. A drive mechanism including a motor and a gear train employing pulley-and-cable assemblies rotates either the wing and flap together such that the flap angle relative to the wing is constant, or to change the flap angle relative to the wing with the wing angle of incidence held constant. The invention also provides a retractable wind-powered propulsion apparatus that is mountable to the hull assembly of a submersible or non-submersible vessel.
US09896151B1	Bicycle pedal A bicycle pedal contains: a body, a plurality of self-lubricating bearings, a connection shaft, a tapered sleeve, and a threaded sleeve. The body includes a through hole configured to accommodate the connection shaft. The connection shaft includes a first taper section and a first screwing section fitting with the tapered sleeve and the threaded sleeve. A second taper section of the tapered sleeve mates with the first tapered section of the connection shaft, the threaded sleeve includes a second screwing section screwing with the first screwing section of the connection shaft, and the threaded sleeve pushes the tapered sleeve. The body of fixed size cooperates with the tapered sleeve of fixed size, multiple connection shafts of various sizes, and multiple threaded sleeves of various sizes so as to adjust a span of the bicycle pedal, and the connection shaft is in connection with the body.
US09896138B2	Drag reducing device A drag reducing device for reducing aerodynamic drag at a trailing end of a moving bluff body includes a first and a second panel, which are movable connected to each other to move together from a collapsed to an extended configuration. At least one bias element is provided for exerting a spring force to the first panel structure to support the movement of the panels. The bias element includes a bendable spring rod. The spring rod extends along a curvature in a pre-tensioned condition in between the first and second panel from a back region B of the drag reducing device to a front region F of the drag reducing device, such that the spring rod exerts a spring force to the panel structure. The spring rod effectively supports at least one panel, while at the same time maintains a simple and reliable configuration of the drag reducing device.
US09896130B2	Guidance system for a vehicle reversing a trailer along an intended backing path A guidance system for a vehicle reversing a trailer is provided. The system includes a display and a controller configured to generate a steering icon on the display. The steering icon recommends a steering direction and a steering magnitude related to a steering device of the vehicle in order to correct a deviation from an intended backing path.
US09896129B2	Driving assistant system of vehicle and method for controlling the same Disclosed herein are a driving assistant system of a vehicle and a driving assistant method. The driving assistant system includes an image acquisition unit that acquires a front image of the vehicle, an obstacle detection unit that detects an obstacle at lateral and rear sides of the vehicle, a determination unit that determines whether a current vehicle is located at a junction road based on the acquired image, and a control unit that automatically changes a lane of the vehicle when it is determined that the current vehicle is located at the junction road and the obstacle is not detected at the lateral or rear side of the vehicle.
US09896125B2	Control apparatus and control method of on-vehicle electronic equipment A control apparatus of an on-vehicle electronic equipment. The control apparatus of the on-vehicle electronic equipment monitors an execution time of each normal processing obtained by subdividing a control program of the on-vehicle electronic equipment by means of an MCU which is provided in the control apparatus. In a case that an abnormality in the execution time of the normal processing is detected by a timer interruption processing based on a general-purpose timer built in the MCU and software, an alternative processing to be paired with the normal processing is performed to continue a control of the on-vehicle electronic equipment by replacing the normal processing with the alternative processing in a next period.
US09896120B2	Steering column assembly A collapsible steering column assembly comprising a steering shaft that is supported within a steering column shroud, the shroud comprising an upper shroud portion and a lower shroud portion, in which the upper shroud portion is located towards the end of the steering shaft that is nearest the steering wheel and the lower portion is located towards the end of the shaft furthest from the steering wheel, the upper portion being at least partially received within the lower portion so that the upper portion can telescopically collapse into the lower portion during a crash, a support bracket that in use is secured to a fixed part of the vehicle and includes two support bracket arms that depend from a base portion to embrace the shroud, a clamp rail that is releasably secured to the upper shroud portion, the clamp rail including a slot that extends generally horizontally, and a clamp pin that extends through an opening in each of the arms of the bracket and through the generally horizontal slot in the rail, the clamp pin carrying a clamp mechanism that is movable between an unclamped position in which the rail can move freely relative to the clamp pin and a clamped position in which the rail is fixed relative to the clamp pin. The rail is secured to the upper shroud portion by a deformable tab which protrudes from the upper shroud portion to hook onto a part of the rail that faces the steering wheel end of the shroud. In use of the assembly with the cam mechanism in the clamped condition the tab is deformable under a predefined load applied to the upper shroud so as to unhook from the rail allowing the upper shroud to move axially relative to the rail and hence relative to the clam pin to permit collapse of the steering column shroud.
US09896113B2	Braking systems for railway cars Braking systems for railway cars are provided. A braking system defines a longitudinal axis, and includes a first brake assembly, a second brake assembly, and an actuator operable to generate a linear force, the actuator disposed proximate the second brake assembly. The braking system further includes a movable rod and a fixed rod extending between the first brake assembly and the second brake assembly. In some embodiments, the braking system further includes a dead lever and a slack adjuster disposed proximate the first brake assembly, the slack adjuster connected to the first brake assembly and the dead lever and operable to adjust a distance along the longitudinal axis between a reference point of the first brake assembly and a pivot point of the dead lever.
US09896110B2	Control method for carrying out a gear shift in a transmission provided with a dual-clutch gearbox A control method for carrying out a gear shift in a transmission provided with a dual-clutch gearbox, so as to shift from a current gear to a following gear; the control method comprises the steps of: receiving a gear shift command; opening a first clutch associated with the current gear; closing a second clutch associated with the following gear; determining whether a driving style is a comfort driving style, an energy efficiency driving style, a sports driving style or a racing driving style; and in case of upshifting, controlling the second clutch after the complete closing of the second clutch, so as to allow said second clutch to temporarily transmit a torque that is greater than the torque to be transmitted by the second clutch immediately after the gear shift and than the torque transmitted by the first clutch immediately before the gear shift, only in case of energy efficiency or racing driving style.
US09896103B2	Vehicle drive controller A running control device of a vehicle includes an engine with cylinders, a clutch connecting/disconnecting a power transmission path between the engine and wheels, and a variable mechanism to vary an intake air amount sucked into the cylinders. The running control device performs a normal running mode by transmitting engine drive force to the wheels, a neutral inertia running mode by disconnecting the power transmission path between the engine and the wheels, and a cylinder resting inertia running mode by resting at least a part of the cylinders while the power transmission path between the engine and the wheels is connected. The running control device makes the intake air amount sucked into the cylinders larger at the time of return from the neutral inertia running mode to the normal running mode as compared to the case of return from the cylinder resting inertia running mode to the normal running mode.
US09896100B2	Automated spatial separation of self-driving vehicles from other vehicles based on occupant preferences A computer-implemented method, system, and/or computer program product automatically provides spatial separation between a self-driving vehicle (SDV) operating in an autonomous mode and another vehicle on a roadway based on an emotional state of at least one occupant of the SDV. One or more processors receive an emotional state descriptor for at least one occupant of the SDV. A vehicle detector on the SDV detects another vehicle within a predefined proximity of the SDV. The processor(s) issue spatial separation instructions to a control mechanisms controller on the SDV to adjust a spacing between the SDV and the other vehicle based on the emotional state descriptor for the occupant(s) in the SDV.
US09896095B2	Collision avoidance support device When a host vehicle travels while being decelerated by an intervention of automatic braking, a support ECU calculates a collision prediction speed at a collision prediction position and determines whether or not the collision prediction speed exceeds a collision prediction speed threshold. The support ECU allows an automatic steering for collision avoidance to intervene only in a case where the collision prediction speed is determined to be equal to or less than the collision prediction speed threshold and prohibits the intervention of the automatic steering in a case where the collision prediction speed is determined to exceed the collision prediction speed threshold.
US09896094B2	Collision avoidance control system and control method A collision avoidance control system includes an ECU, and the ECU calculates an own vehicle course as a course along which an own vehicle is expected to proceed during a first transfer prediction time, and time-dependent own vehicle positions on the own vehicle course, and calculates an oncoming vehicle course as a course along which an oncoming vehicle is expected to proceed during a second transfer prediction time, and time-depending oncoming vehicle positions on the oncoming vehicle course. When it is determined that the own vehicle or oncoming vehicle is traveling on a curve, the ECU sets the first transfer prediction time and the second transfer prediction time such that at least one of the first transfer prediction time or the second transfer prediction time is set to a shorter time, as compared with the case where neither of the own vehicle and the oncoming vehicle is traveling on a curve, determines whether one of the own vehicle positions overlaps a corresponding one of the oncoming vehicle positions, and performs avoidance control according to the result of determination.
US09896085B2	Vehicle information processor In the first mode, the vehicle gives priority to traveling in which only the motor is driven. In the second mode, the vehicle drives at least one of the internal combustion engine and the motor to sustain a stored power amount of the storage battery. At least one of a plurality of zones includes a load unknown portion, in which the travel load cannot be calculated. The planning unit is configured to set a zone including the load unknown portion to the first mode.
US09896074B2	Booster and brake apparatus using the same An input rod is operated by a brake pedal to introduce the air into a variable-pressure chamber through a control valve to propel a power piston, thereby advancing a primary piston to generate a brake fluid pressure in a master cylinder. A part of the reaction force from the fluid pressure is transmitted to the input rod through a reaction member. The primary piston is provided with an idle stroke in which no fluid pressure is generated, and the reaction force to be transmitted to a plunger is limited by a reaction force adjusting spring. In the region of the idle stroke, a fluid pressure is supplied to a wheel cylinder through a fluid pressure control unit to perform regenerative cooperative control, and a reaction force from a reaction spring is applied to the input rod.
US09896065B2	Heating device for a wiper blade of a vehicle and wiper blade comprising same The heating device is suitable for assembly with an element (3) supporting a wiper blade and comprises an element of longitudinal main axis (4) suitable for mounting inside a housing (5) of the support element (3) so as to form a spine. A heating element (13) is positioned on a bottom face of the spine-forming element (4). The spine-forming element (4) comprises at least one bushing (20) for the passage of electrical conduction means (19) in order to provide an electrical power supply for the heating element (13).
US09896060B2	Wireless seatbelt attaching detection device There are provided a buckle switch that detects an insertion of a tongue into a buckle of a seatbelt and an ejection of the tongue from the buckle, a signal transmitting section that wirelessly transmits a signal showing a state of the buckle switch, and an attaching detection control unit that controls the signal transmitting section such that the signal transmitting section transmits different signals that correspond to a first time lasting from the insertion of the tongue into the buckle until the ejection of the tongue from the buckle or a second time lasting from the ejection of the tongue from the buckle until the insertion of the tongue into the buckle.
US09896052B2	Cargo bed and utility vehicle with the cargo bed A cargo bed of a utility vehicle includes a front wall, a left wall, a right wall, a rear wall, and a partition member configured to partition a storage space that is surrounded by the front wall, the left wall, the right wall, and the rear wall. The left wall and the right wall are each provided with a first groove configured to be engaged with the partition member to fix the same, and a second groove configured to store the partition member.
US09896047B2	Power supply apparatus and vehicle including the same An ECU controls drive signals output to relays. A current sensor detects current flowing between one of the relays and a power supply port. A connection circuit is configured to electrically connect a first section with a second section when only one of the drive signals is placed into an active state by the ECU. The first section is a portion of a first one of power lines between the current sensor and the power supply port. The second section is a portion of a second one of the power lines between the relay and the power supply port.
US09896045B2	Touch activated, wireless switches Modular wireless switch system for use in an aircraft, which may include an integrated LED backlight. The system includes a master module having a power supply, a switch, and a wireless communicator configured to communicate a switch state. The system also includes a slave module connectable to the master module, which has a second switch and which is configured to communicate a second switch state using the wireless communicator. All wireless communications may be handled by the master module using a protocol such as ZigBee™. All communications from the slave module may be transmitted to the master module via a wired bus. Additional slave modules are connectable to the bus as desired.
US09896024B1	Tamper resistant and theft resistant vehicle light assembly A tamper resistant and theft resistant light assembly for a tractor trailer or other vehicle that can be easily installed on the vehicle but cannot be removed without being broken. The light assembly may have one or more flexible projection fingers that deform to allow the light assembly to be mounted on the vehicle body plate by pushing the light assembly into an opening therein, but prevent the light assembly from being removed from the opening. The light assembly has a mounting ring that breaks away from the light assembly if an attempt is made to pry the light assembly out of the opening.
US09896020B2	Vehicle lighting assembly A lighting assembly for a vehicle is provided herein. The lighting assembly includes first and second sets of light sources disposed on a bumper of the vehicle. A photoluminescent structure is disposed on the lighting assembly and configured to luminesce in response to excitation by the first or second sets of light sources. A detection system is configured to detect an object disposed proximately to the vehicle. The first or second set of light sources illuminate upon the detection of the object.
US09896016B2	Vehicle containment and transport systems and methods A system for storage, transportation, and display of a vehicle in accordance with the present disclosure has a housing comprising at least two female indentations and each indentation has tapered walls that form a cavity. Additionally, the system has a trailer having at least two protrusions. The trailer has a first protrusion on a first leg of the trailer and a second protrusion on a second leg of the trailer and the protrusions are arranged to mate with the at least two female indentations when the housing is placed on the trailer. Further, the system has a chock stand positioned for receiving a wheel of a vehicle, the chock stand coupled to a floor of the housing.
US09896013B2	Vehicle automatic hoist system and method Systems and methods for controlling a hoist apparatus on a vehicle to automatically load and unload a container. The vehicle includes a chassis, a hoist apparatus coupled with the chassis, and at least one lift mechanism operative to move the hoist apparatus with respect to the chassis in response to the flow of hydraulic fluid along a fluid flow path. The vehicle also includes at least one valve in fluid communication with the at least one lift mechanism, a control system in electronic communication with the at least one valve, and a transceiver in electronic communication with the control system. The control system is operative to receive, via the transceiver, an initiation signal from a remote control unit. Further, the control system is operative to selectively actuate the at least one valve in response to the initiation signal to move the hoist apparatus.
US09896009B2	Seat cushion of vehicle The present disclosure provides a seat cushion of a vehicle, the seat cushion including: a body coupled to a seat cushion; an extension disposed ahead of the body and being movable forward and backward; and an elastic member disposed in a space between the body and the extension and filling in the space between the body and the extension when the extension moves forward.
US09896008B2	Cover anchor clip A cover anchor clip comprising a base section that is a rectangular shaped plate body for retention in a foam body, and that is formed with a plurality of through holes into which the foam body enters, the plurality of through holes are lined up along a length direction of the base section in a plurality of rows; and a plurality of anchor portions that are formed standing out from the base section side-by-side in the length direction of the base section, and each of that is configured to anchor an anchored portion fixed to a cover for covering the foam body, wherein a notch is formed to one edge out of a pair of edges of the base section, the pair of edges extends in the length direction of the base section.
US09896001B1	Swivel base assembly with fore/aft/rotational movement and warping features Systems and methods for swivel base assemblies for seats are provided. A swivel base assembly for an aircraft seat may comprise a swivel center beam, a swivel plate pivotally coupled to the swivel center beam, the swivel plate configured to rotate with respect to the swivel center beam about a first centerline axis, a first side rail coupled to the swivel center beam, and a second side rail coupled to the swivel center beam, the swivel center beam being located between the first side rail and the second side rail.
US09895997B2	Drive system, transporter, electrical device, and control method for drive system A drive system includes a first energy storage, a second energy storage, a driver, and a controller. The first energy storage is charged and discharged. A first amount of heat is generated by charging and discharging the first energy storage. The second energy storage is charged and discharged. The second amount of heat is generated by charging and discharging the second energy storage and is smaller than the first amount of heat. The driver generates driving power to move an electrically powered vehicle with electric power supplied from at least one of the first energy storage and the second energy storage. The controller controls temperature of the first energy storage and temperature of the second energy storage with a coolant flowing inside the electrically powered vehicle. The first energy storage is cooled by the coolant before the second energy storage is cooled by the coolant.
US09895990B2	Method for programming energy flow between a grid and an accumulator of an electric vehicle, and corresponding device for programming A method for recharging an accumulator of an electric vehicle is disclosed, the method including recording information on past usages of the accumulator locally at a point of connection of the accumulator to a grid; locally estimating information on a future usage of the accumulator, taking in input the information on past usages; and locally programming an energy flow between the grid and the accumulator based on the estimated information.
US09895976B2	Inductive pick-up arrangement for an electric vehicle and method of operating an electric vehicle The invention relates to an inductive pick-up to be mounted on an electric vehicle, operated with electric energy produced by the inductive pick-up by magnetic induction. The inductive pick-up includes a pick-up portion, a mounting portion, and an actuator. The invention also relates to an electric land vehicle including an inductive pick-up mounted at the bottom of the vehicle. The invention also relates to a method of operating an electric vehicle having an inductive pick-up portion.
US09895975B2	Bar type display apparatus and vehicle comprising the same Disclosed is a bar type display apparatus which is capable of providing various information without obstructing a front view of a driver, and a vehicle comprising the same, wherein the bar type display apparatus may include a display module provided on a dashboard and disposed adjacent to a lower portion of a front glass of a vehicle, wherein the display module extends from one edge of the dashboard to the other edge of the dashboard.
US09895974B2	Vehicle control apparatus A vehicle control apparatus includes a first acquisition portion acquiring a captured image data outputted from an imaging portion that is provided at a vehicle and that images a surrounding of the vehicle, a second acquisition portion acquiring an inclination angle of the vehicle on a basis of a state information of the vehicle, the state information outputted from a vehicle state detection portion that is provided at the vehicle, and an output portion being configured to output an output image data to a display device, the output image data including the captured image data and an inclination angle display information indicating the inclination angle of the vehicle, the output portion changing a display method within the output image data in accordance with the inclination angle of the vehicle and outputting the output image data.
US09895969B2	Push-push latch A push-push latch includes a slider slidably disposed on a frame. A resilient element is to urge the slider toward an extended state. The slider or the frame defines a cam-track. A pin member is connected to the frame or the slider. The pin member selectably engages a closed course in the cam-track to cause the slider to alternate between a retracted state and the extended state in response to alternating application and removal of an actuating force on the slider. An interference member is on the frame to selectively prevent the pin member from engaging the closed course thereby locking the slider in the retracted state. A pivotable catch is rotatably on the slider to open in the extended state and to close in the retracted state. A shape memory alloy actuator selectively causes the interference member to selectively prevent the pin member from engaging the closed course.
US09895968B2	Fuel supply system An object is to provide a fuel supply system having a filler neck formed easily with high accuracy. A fuel supply system is configured to supply fuel ejected from a fuel nozzle to a fuel tank. The fuel supply system comprises a filler neck including a resin filler neck body and a metal retainer. The filler neck body is formed in a tubular shape and has an opening end arranged to form an opening which the fuel nozzle is inserted through. The retainer is placed to cover at least part of the opening end of the filler neck body and is joined with the filler neck body in at least part of the filler neck body by thermal welding.
US09895965B2	Passively controlled dual-state vacuum switchable mount Methods and systems are provided for a dual state hydromount in order to passively introduce air underneath a decoupler such that the stiffness of the air pocket adds to the stiffness of the decoupler, thereby increasing a level of damping available in a vehicle ride mode, the ride mode defined by vehicle speeds greater than a threshold speed. In one example, a dual state hydromount is described wherein a partitioning structure may be alternately coupled to either vacuum or atmosphere, and when coupled to atmosphere an air spring is created under the decoupler via the passive directing of air to the decoupler via a one way check valve. In this way, introduction of an air spring is achieved without additional active control.
US09895961B2	Airflow outlet An airflow outlet comprising at least a first plurality of airflow direction elements, a second plurality of airflow direction elements, and an actuation system is provided. Each of the respective first airflow direction elements and second airflow direction elements include a vane shaft and at least one vane element disposed along the vane shaft and integrally coupled thereto. The actuation system is configured to control the position of the vane elements of each of the airflow direction elements. The actuation system includes a drive element engaged with the driven element, which is further engaged with the vane shafts of each of the airflow direction elements. A rotation of the drive element causes a proportional rotation of the vane elements of the each of the airflow direction elements to an operating position, which defines an airflow direction through the airflow outlet.
US09895952B2	Two-stage sway bar Sway bars are described that include at least an inner sway bar, a first outer sway bar, and a second outer sway bar. The sway bar includes a first coupling portion and a second coupling portion that can engage and disengage under control from a remote location. The sway bar includes a larger diameter, outer sway bar assembly that can be disengaged and a smaller diameter inner sway bar. The sway bar can include a housing to retain fluid.
US09895951B2	Electromechanical actuating drive An electric roll control stabilizer for a vehicle, having an outer housing that rotates about a longitudinal axis, a wiring harness has at least one electric supply lead and/or electric control lead is connected at its first end to a first connection terminal provided on the outer housing and at its second end to a second fixed in position connection terminal. In an area of the first terminal, the harness extends tangential to or concentrical with an outer enveloping surface of the outer housing or a cylindrical structural element which is attached rotationally fixed and whose outer diameter is smaller than the diameter of the outer housing. From the area of the first terminal, the wiring harness extends concentrically with and is spaced from the outer enveloping surface, and the wiring harness is arranged in a transverse plane of the outer housing or the cylindrical structural element that passes through the first terminal.
US09895943B2	Method of checking the pressure of an aircraft tire A method of checking the pressure of a tire of an aircraft. A pressure reading is taken from the tire with a pressure sensor and wirelessly transmitted to a hand-held device. The hand-held device receives the pressure reading, an aircraft ID which uniquely identifies the aircraft, and a tire ID. The device then retrieves from a memory a reference pressure level associated in the memory with the aircraft ID and the tire ID; compares either the pressure reading, or an adjusted pressure based on the pressure reading, with the reference pressure level; and displays a warning if the pressure reading, or the adjusted pressure based on the pressure reading, is below the reference pressure level.
US09895941B2	Aircraft tire pressure monitoring system A monitoring system, having a processor, provides pressure warnings associated with a tire of an aircraft When the aircraft is stationary, the processor operates in a maintenance mode and receives a first pressure measurement indicating a pressure of the tire; compares the first pressure measurement with a maintenance mode low pressure threshold, and causes the flight deck display to display a low pressure warning associated if the first pressure measurement is below the maintenance mode low pressure threshold. When the aircraft is in motion, the processor operates in a flight mode and receives a second pressure measurement indicating a pressure of the tire, compares the second pressure measurement with an abnormal pressure threshold which is lower than the maintenance mode low pressure threshold, and causes the flight deck display to display an abnormal pressure warning if the second pressure measurement is below the abnormal pressure threshold.
US09895939B2	Run-flat tire and method for mounting the same on four-wheeled vehicle A run-flat tire 1 comprises a carcass 6, a pair of side reinforcing rubber layers 9, and a pair of sidewall rubber components 10. At a tire maximum-width position, a first side reinforcing rubber layer 9A disposed in the side of a first bead portion has a thickness B1 greater than a thickness B2 of a second side reinforcing rubber layer disposed in the side of a second bead portion, and a first sidewall rubber component disposed in the side of the first bead portion has a thickness A1 smaller than a thickness A2 of a second sidewall rubber component disposed in the side of the second bead portion.
US09895938B2	Tire bead for aircraft Aircraft tire (1) comprising two beads (2). In each bead (2) portion (8) comprises surface layer (9) in contact with rim (3) via radially interior bead face (4) and having a shear stiffness K1. Portion (8) comprises a rigid layer (10), radially on the outside of and adjacent to the surface layer (9), having a shear stiffness K2 at least equal to five times the shear stiffness K1 of the surface layer (9), and a deformable layer (11), radially on the outside of and adjacent to the rigid layer (10) and radially on the inside of and adjacent to the carcass reinforcement portion (5) radially on the inside of the bead wire (7), having a shear stiffness K3 at most equal to 0.3 times the shear stiffness K1 of the surface layer (9).
US09895933B2	Non-pneumatic tire A non-pneumatic tire has high durability performance. A non-pneumatic tire is provided with: an annular tread section (2) which comes into contact with the road surface; an annular inner peripheral section (3) which is located on the inside of the tread section (2) in the radial direction of the tire; and a plurality of connection sections (4) which connect the tread section (2) and the inner peripheral section (3). The connection sections (4), the inner surface (2b) of the tread section (2), and/or the outer surface (3a) of the inner peripheral section (3) is provided with a plurality of dimples (5).
US09895932B2	Tire tube A tire tube includes a tube body and two connectors. The tube body includes an air jet, a first end and a second end. The two connectors are connected to the first end and the second end of the tube body respectively. One of the connectors includes an operating portion corresponding to a tube core of the tube body.
US09895928B2	Spherical wheel intended for moving a vehicle and vehicle using the wheel A spherical wheel to move a vehicle comprises two caps, the surface of which follows the spherical surface of the wheel, the caps being articulated by means of a pivot link relative to a shaft. The wheel further comprises two casters each arranged in an opening of each of the caps, the opening centered about the axis of the corresponding pivot link, each caster arranged in the extension of the pivot link of the cap concerned. Each caster ensures a rolling at the level of the spherical surface. Radii S of the opening of each cap and r of the corresponding caster are defined to substantially balance forces needed to drive a cap and the corresponding caster when the wheel goes from bearing on the ground on a cap at the edge of the opening to bearing on the ground on the corresponding caster.
US09895927B2	Protector shield for a sidewall of a motor vehicle tire, and a wheel assembly for such a vehicle incorporating it The present invention relates to a protector shield for at least one sidewall of a motor vehicle tire, and to a wheel assembly for a motor vehicle incorporating this protector shield. The invention particularly but non exclusively concerns the fire protection against flames and/or said flammable substances, such as oil or Molotov cocktails, as well as a high solvent and/or acid resistance, especially in hostile environments. A protector shield of the invention is in a form of a curved ring designed to be mounted on a wheel rim receiving said tire and, according to the invention, the shield includes a fire protection part which defines an outer convex face of said shield and which comprises a cross-linked rubber composition which particularly exhibits flame retardant and heat resistance properties for imparting to said tire an improved fire protection against flames and/or flammable substances.
US09895924B2	Articulated pen Articulated pens are provided. A pen includes: a shank; an ink tube comprising a first section, a second section, a third section, and a fourth section; a writing tip connected to the fourth section; a first guide rail connected to the shank and that bends the ink tube at a first angle between the first section and the second section; and a second guide rail pivotally connected to the first guide rail and that bends the ink tube at a second angle between the third section and the fourth section. Pivoting the second guide rail relative to the first guide rail adjusts a third angle between the second section and the third section.
US09895922B2	Ring binder with interlocking ring members A ring binder for use in holding loose-leaf pages. A retaining system is configured to selectively and releasably hold first and second ring members in a closed position. First and second interlocking formations are selectively movable relative to one another between a retaining position and a non-retaining position. The first interlocking formation includes a projection having a free end. The free end has a void configured and arranged to permit resilient bending of portions of the free end of the projection in a first direction as they engage the second interlocking formation when the interlocking formations are moved from the non-retaining position to the retaining position. In the retaining position, the portions of the free end of the projection are substantially inhibited from bending in a second direction in response to pivoting movement of either of the ring members.
US09895916B2	Print head support assembly and inkjet printer comprising such assembly In a print head support assembly for carrying a number of print heads and for positioning the number of print heads, the print head support assembly includes a carriage plate provided with reference elements for positioning the number of print heads, the carriage plate being further provided with at least four support positions and a support sub-assembly provided with at least four adjustable mounting points for coupling to said at least four support positions and for supporting the carriage plate at said at least four support positions. The support sub-assembly is configured to constrain the carriage plate in six degrees of freedom with respect to a position of the carriage plate and to constrain the carriage plate in at least one degree of freedom with respect to a shape of the carriage plate. Thus, a light-weight and compliant carriage plate may be used to provide for a light-weight carriage suitable for high-speed printing.
US09895903B2	Method and system for gilding a substrate The invention relates to a method for the gilding of a substrate with the application of pressure between the zones of the substrate to be gilded and a gilding sheet comprising a gilding film and a transfer layer, characterized by the consecutive treatment of the gilded substrate, allowing the adhesion performance of the gilding sheet in relation to the substrate to be optimized while improving the visual quality of the gilding deposit on the substrate.
US09895902B2	Compliant micro device transfer head A compliant micro device transfer head and head array are disclosed. In an embodiment a micro device transfer head includes a spring portion that is deflectable into a space between a base substrate and the spring portion.
US09895900B2	Liquid cartridge having structure for opening and closing liquid channel and air channel A liquid cartridge includes a resin frame, a valve and a wall member. The frame defines a portion of a liquid chamber configured to store liquid and a portion of a valve chamber in communication with the liquid chamber, the valve chamber extending in a first direction away from the liquid chamber and having one end in the first direction at which a liquid outlet is provided to provide communication between the valve chamber and an outside of the liquid cartridge, the frame having a wall portion defining a portion of the valve chamber. The valve is disposed within the valve chamber and movable in a second direction opposite the first direction, the valve having a closing part configured to open and close the liquid outlet in accordance with movement of the valve. The wall member defines the valve chamber together with the wall portion of the frame.
US09895899B2	Consumable supply item A consumable supply item for an imaging device holds an initial or refillable volume of ink. A housing defines an interior having a pair of opposed electrodes. The electrodes have a capacitance that varies in response to an amount of liquid between them. A controller energizes one electrode and receives an output reading from the other. The controller processes the reading on board the housing and supplies it as a digital data stream to the imaging device during use. A memory stores calibration values for an empty and full housing. The controller writes back to the memory present fluid levels obtained from the output reading of the electrode. An enable output allows operation or not of a fluid pump in the imaging device. Materials, construction, modularity, and fluid communication ports are further embodiments, to name a few.
US09895897B2	Selectively provide pressure differences between reservoirs to cause printing fluid movement A printing apparatus, a printing system and a method are disclosed. The method of moving printing fluid within a printing apparatus includes selectively providing a first pressure difference between a first reservoir and a second reservoir by a differential pressure system to cause the printing fluid to move from the first reservoir through a printing fluid applicator to the second reservoir. The method also includes selectively providing a second pressure difference between the first reservoir and the second reservoir by the different pressure system to cause the printing fluid to move from the second reservoir through the printing fluid applicator to the first reservoir.
US09895895B2	Head washing device and inkjet printer In order to effectively wash wiping members, a washing station which is a head washing device according to one embodiment of the present invention is characterized by including a wiping unit, a storage tank, and a washing unit. The wiping unit includes wipers which are wiping members for wiping an ejection surface of an inkjet head. In the storage tank, washing solution for washing the wiping unit is stored. The washing unit washes the wipers in the washing solution of the storage tank.
US09895889B2	Printhead assembly Examples of a printhead assembly are disclosed herein. An example of the printhead assembly includes a die to print, a base member, and at least one electrode. The electrode may be used to provide a charge to attract and collect particles that would normally otherwise interfere with operation of the die.
US09895886B2	Droplet deposition apparatus and method for manufacturing the same A droplet deposition apparatus, such as an inkjet printhead, that includes an integrally-formed manifold component and one or more actuator components; these actuator components provide an first array of fluid chambers, each of which has a piezoelectric actuator element and a nozzle, with this piezoelectric actuator element being able to cause the release in a deposition direction of fluid droplets through the nozzle in response to electrical signals; the first array of fluid chambers extends in an array direction from a first longitudinal end to a second, opposite longitudinal end, this array direction being perpendicular to the deposition direction; in addition, the manifold component is elongate in the array direction and includes a first and second manifold chambers, with these manifold chambers extending side-by-side in the array direction and the first manifold chamber being fluidically connected to the second manifold chamber via each of the fluid chambers in the first array; the cross-sectional area of at least one of these manifold chambers is tapered with distance in the array direction, for example to improve purging of the chambers during start-up; the cross-sectional shape of the integrally-formed manifold component perpendicular to the array direction varies with distance in the array direction such that the centroid of the cross-section remains a substantially constant distance, in said deposition direction, from said array of fluid chambers over the length of the first array of fluid chambers, with the integrally-formed manifold component thus being essentially self-stiffening.
US09895878B2	Liquid droplet ejecting apparatus A printing apparatus (liquid droplet ejecting apparatus) includes a detector configured to output a first signal which denotes that a medium is not supported on a support face of a medium support unit, and a second signal which denotes that a medium is supported on the support face; and a controller that limits executing of a printing operation when the first signal in received and allows executing of a printing operation when the second signal is received. The controller is configured to ignore the first signal or interpret the first signal as the second signal under a specified condition.
US09895871B2	De-bonding and cleaning process and system Methods and tools for de-bonding and cleaning substrates are disclosed. A method includes de-bonding a surface of a first substrate from a second substrate, and after de-bonding, cleaning the surface of the first substrate. The cleaning comprises physically contacting a cleaning mechanism to the surface of the first substrate. A tool includes a de-bonding module and a cleaning module. The de-bonding module comprises a first chuck, a radiation source configured to emit radiation toward the first chuck, and a first robot arm having a vacuum system. The vacuum system is configured to secure and remove a substrate from the first chuck. The cleaning module comprises a second chuck, a spray nozzle configured to spray a fluid toward the second chuck, and a second robot arm having a cleaning device configured to physically contact the cleaning device to a substrate on the second chuck.
US09895869B2	Sheet material adhesive agent application method A sheet material adhesive agent application method includes first and second actions. The first action is performed sequentially for stacked multiple sheet materials. The first action is implemented by: taking out an uppermost one of the multiple sheet materials; transferring the taken-out sheet material to an adhesive agent application stage; and applying the adhesive agent to the transferred sheet material at the adhesive agent application stage. The second action is performed in advance to the first action, wherein the second action is implemented by setting an uppermost group of sheet materials so that each sheet material of the uppermost group has a predetermined curvature projecting upward. The first action is completed before the sheet material is restored to a state before the second action.
US09895867B2	Laminated molded body The present invention has an object to provide a laminated molded body in which a thin fiber reinforced layer is laminated and having a favorable strength characteristic. The laminated molded body (1) includes a laminated portion (a laminated portion of SR1 on an upper side and SR1, for example) in which fiber reinforced layers SR1 to SRn, each having a thickness of 20 to 80 μm in which a reinforcing fiber material is dispersed in a thermosetting resin material which serves as a matrix, are laminated, and a laminated portion in which a resin layer is laminated between the fiber reinforced layers (a laminated portion of SR2 on the upper side, TP1, and SR3, for example).
US09895865B2	Polymer film for in-mould labelling The invention relates to a multi-layered, opaque, biaxially-oriented polyolefin film with a thickness of less than 150 mum and which comprises f. a base layer that contains vacuoles and at least one polymer of at least one olefin, g. an inner intermediate layer that contains at least one polymer of at least one olefin, h. an outer intermediate layer that contains at least one polymer of at least one olefin, i. an inner cover layer which is in contact with the inner intermediate layer and contains 5-70 wt. % of at least one polyethylene and 30-95 wt. % of at least one propylene polymer, and j. an outer cover layer which is in contact with the outer intermediate layer and contains 5-70 wt. % of at least one polyethylene and 30-95% of at least one propylene polymer, each amount indication relating to the weight of the layer in question, and characterized in that said outer intermediate layer has a thickness of 0.5 to 5 mum and contains 4.5 to 30 wt. % of pigments, preferably Tau[Iota]Omicron2, in that the outer cover layer has a thickness of >0 to <2 mum, and in that the film has a gloss on either side of less than 50 gloss units measured according to DIN EN ISO 2813 at an angle of 60 DEG and at a temperature of 25 DEG C.
US09895862B2	Multi-layered assembly with tight peel control Embodiments disclosed herein provide for multi-layered assemblies comprising a carrier having opposed sides; a heat sealable layer disposed on at least a portion of one of said sides of the carrier, said heat sealable layer comprising a partially salt neutralized ionomer; and a polymeric film comprising polyurethane and having opposed sides, wherein one of said sides of the polymeric film is in at least partial contact with said heat sealable layer, methods of making the same as well as other variations.
US09895858B2	Sheet processing apparatus, method for controlling sheet processing apparatus, and storage medium A sheet processing apparatus includes a processing unit, a sheet discharge unit, a determination unit, and a control unit. The processing unit performs crease processing on a sheet. The sheet discharge unit discharges a sheet having been subjected to the crease processing by the processing unit. The determination unit determines whether a number of the discharged sheets having been subjected to the crease processing exceeds a predetermined number of sheets. The control unit performs control to cause the discharge unit to discharge a sheet. In a case where the determination unit determines that the number of the discharged sheets having been subjected to the crease processing exceeds the predetermined number of sheets, the control unit performs control to cause the discharge unit to not discharge sheets having been subjected to the crease processing onto the discharge destination.
US09895853B2	Holographic storage layer, holographic disk using the same, and method for manufacturing the same A holographic storage layer includes a reflective structure and photosensitive units. The reflective structure is a grid-shaped structure and includes cavities. The photosensitive units are disposed in the cavities, in which each of the photosensitive units is surrounded by the reflective structure. First openings and second openings are defined by the reflective structure, and the photosensitive units are exposed by the first openings and the second openings respectively.
US09895852B2	Method for producing a composite body The invention relates to a method for producing a composite body and to a composite body produced using the method, wherein the composite body (10) is formed as a pressure pipe or as a pressure container, wherein the composite body is composed of a main body (13) that is made of steel and of a coat (14) that is made of a fiber composite (15), said coat enclosing the outside of the main body at least in some sections, wherein, for forming the fiber composite, a fibrous material is wound around the main body, wherein the fibrous material is impregnated with a resin before or after winding, wherein the wound and impregnated fibrous material is heated in order to form the fiber composite, wherein the method is carried out in situ on a built-in pressure pipe or pressure container, wherein the wound and impregnated fibrous material is heated to up to 700° C.
US09895849B2	Method of manufacturing a wind turbine blade using pre-fabricated stacks of reinforcing material A method of manufacturing a wind turbine blade using pre-fabricated stacks of reinforcing material is described. The stacks 14 comprise a plurality of plies of fiber material, joined together along a side edge to form a spine. The opposite edges of the stack are left unjoined so that the plies can separate and slide across one another. In doing so, the stacks can be stored flat, but on installation into a curved mold 12 profile, the plies may slide to adopt the curved shape of the mold. The stacks extend from a point near the leading or trailing edge of the mold to an intermediate point on the mold surface. The stacks may be used to construct the thickened root section of a wind turbine blade.
US09895843B2	Systems and methods for an improved peel operation during additive fabrication According to some aspects, a method of additive fabrication wherein a plurality of layers of material are formed on a build platform is provided. The method may comprise forming a layer of material in contact with a container, and subsequent to the forming of the layer of material, rotating the container relative to the build platform and moving the build platform relative to the container, thereby creating an effective fulcrum about an axis, wherein the rotating of the container and moving of the build platform causes the layer of material to separate from the container. According to some embodiments, the container may be configured to rotate about a fixed axis. According to some embodiments, moving the build platform may comprise moving the build platform toward the container.
US09895839B2	Fastening structure A fastening structure (10) includes: a resin member (14) that contains a resin material, and that has a through-hole (14H) for mounting having a tapered inner wall surface (14T); a member for fastening (16) that is made of metal, and that has a collar portion (16C) that is inserted within the through-hole (14H) for mounting and whose intermediate portion has a tapered outer wall surface (16T) that abuts the tapered inner wall surface (14T), and a flange portion (16F) that projects out along an obverse face of the resin member (14) at an end portion (16Z) at a large-diameter side of the collar portion (16C); and an adhesive (18) that is provided between the obverse face (14A) of the resin member and the flange portion (16F), and that adheres the resin member (14) and the member for fastening (16).
US09895838B2	Resin mold for nanoimprinting and production method thereof A resin mold for nanoimprinting has a substrate, a resin layer formed upon the substrate and having a depressions and protrusions pattern on a surface, an inorganic substance layer formed of uniform thickness on at least the surface having the depressions and protrusions pattern of the resin layer, and a mold release agent layer formed of uniform thickness on at least the surface having the depressions and protrusions pattern of the inorganic substance layer. The resin of the resin layer includes constituent units derived from an epoxy group-containing unsaturated compound at a concentration of 1 to 50 percent relative to total constituent units, and the epoxy value is 7.0×10−4 to 4.0×10−2.
US09895831B2	Compression-molded parts having an embedded conductive layer and method for making same A compression-molded part has a conductive layer embedded in the part during molding of the part. The conductive layer is generally adjacent an outer surface of the part and is preferably formed from a mesh, a foil, a pulled screen, or multiple layers of conductive elements. The part is preferably optimized for use on the exterior of an aircraft for lightning-strike or EMI protection or for use as an antenna. Methods for forming the panels of the invention include placing the conductive layer against a mold surface of a compression mold, then forming the compression-molded part with the conductive layer embedded in the part.
US09895827B2	Method and manufacturing system for producing prefabricated parts from mineral-bound building materials A method and manufacturing system for producing prefabricated parts of mineral-bound building materials, in particular for construction of buildings is disclosed. The manufacturing system includes at least one formwork table provided for casting the prefabricated parts of mineral-bound building materials as the essential component. The manufacturing system is mobile and it can be brought to the site of use of the prefabricated parts and in particular to the erection site of a building for manufacturing the prefabricated parts. Thus, this mobility allows transporting a complete small factory for manufacturing prefabricated parts of mineral-bound building materials to very different locations.
US09895823B2	Miter saw An improved miter saw, including a base, a workbench, a stop plate, a swing arm, a motor, a cutting assembly, and an extension platform. The workbench is rotationally disposed on the base. The swing arm is rotationally disposed on the rear of the workbench. The stop plate is disposed on the rear of the base. The extension platform is disposed on two sides of the base. The upper surface of the extension platform and the supporting surface of the base are in a same plane. The extension platform is movably connected to the base through a guide rod. The extension platform comprises an L-shaped limit block and a recess corresponding to the L-shaped limit block. The L-shaped limit block is adapted to turn over in the recess horizontally or vertically along the length direction of a workpiece mounted on the workbench for cutting.
US09895814B2	Industrial robot with at least one drive A robotic arm of an industrial robot includes successive links connected by joints having respective drives and associated transmissions for moving the links. First and second links have respective first and second housings that transfer forces and moments arising from the weight of the robotic arm, or a load carried by the arm, to adjacent links. A first drive rotatably connecting the first and second links includes a drive housing, a rotor, and a stator connected to the drive housing. The drive housing is fastened to the first housing of the first link and forms an external wall of the robotic arm. The transmission associated with the first drive includes an input link that is joined with the rotor of the first drive. An output of the first drive is connected to a flange that is fastened to the second housing and rotatable relative to the drive housing.
US09895810B2	Cooperation system having machine tool and robot A cooperation system of a robot and a machine tool, capable of obtaining a coordinate transformation means with high accuracy by a simple configuration, by which a robot coordinate system is transformed to a machine coordinate system. A provisional coordinate system is defined by coordinate values of three calibration markers in a base coordinate system obtained by translating the machine coordinate system, and a coordinate transformation matrix from the provisional coordinate system to the base coordinate system is calculated. The positions of the markers in the robot coordinate system are obtained by capturing the markers by a camera. Based on the three coordinate values in the robot coordinate system, a coordinate transformation matrix from the robot coordinate system to the provisional coordinate system is calculated, and a coordinate transformation matrix from the robot coordinate system to the base coordinate system is calculated based on the above two matrixes.
US09895804B1	Failure mode A control system of a robotic device may receive sensor data indicating at least one deviation from a nominal operating parameter of the robotic device, where the robotic device includes articulable legs that include respective actuators, and where one or more strokes of the actuators cause the articulable legs to articulate. Based on the received sensor data, the control system may determine that the at least one deviation exceeds a pre-determined threshold. In response to determining that the at least one deviation exceeds the pre-determined threshold, the control system may provide instructions for centering the one or more strokes at approximately a mid-point of extension of the actuators, and reducing a stroke length of the one or more strokes of the actuators.
US09895802B1	Projection of interactive map data Methods and systems for robot cloud computing are described. Within examples, cloud-based computing generally refers to networked computer architectures in which application execution and storage may be divided, to some extent, between client and server devices. A robot may be any device that has a computing ability and interacts with its surroundings with an actuation capability (e.g., electromechanical capabilities). A client device may be configured as a robot including various sensors and devices in the forms of modules, and different modules may be added or removed from robot depending on requirements. In some example, a robot may be configured to receive a second device, such as mobile phone, that may be configured to function as an accessory or a “brain” of the robot. A robot may interact with the cloud to perform any number of actions, such as to share information with other cloud computing devices.
US09895801B2	Offline teaching device using simulation An offline teaching device has a calculation unit which calculates a second position of a second tool on a work line which is separated by a predetermined distance from a first position of a first tool on the work line, calculates a workpiece position where the first tool in the first position contacts or adjoins the workpiece, and calculates a workpiece position and posture such that the second tool in the second position contacts or adjoins the workpiece by changing the posture of the workpiece from the workpiece position with respect to the first tool, while maintaining the work posture of the first tool, and has a generation unit which generates a robot teaching position based on the position and posture of the workpiece and the holding position of the workpiece, and generates a program such that the first tool and the second tool pass along the work line.
US09895791B2	Shaping apparatus for finishing surfaces The invention relates to finishing metallic and non-metallic surfaces by abrasion techniques. In certain embodiments, the invention pertains to an apparatus configured for finishing a zone on the surface of a bladed article of manufacture, wherein the apparatus comprises one or more channels having a cross-sectional profile including at least one finishing area to finish an operative zone of the article that optimizes a clearance portion of the article, wherein an angle of each finishing area of the cross-sectional profile is substantively the same as an optimal clearance angle of the article, wherein the apparatus is configured to position the operable zone of the article along the angle of the finishing area during sharpening.
US09895782B2	Linear drive for machining of an optical workpiece A linear drive and its use for machining an optical workpiece are proposed, the linear drive having a linear movable rotor, a linearly movable compensating body and an electrical compensating drive for movement of the compensating body opposite to the rotor and the rotor extending into the compensating drive and/or a first bearing arrangement mounting the rotor in a torsionally stiff manner and a second bearing arrangement pivotally mounting the rotor.
US09895766B2	All-in-one jigless projection loading system and body component assembling method using the same for vehicle An all-in-one jigless projection loading system for a vehicle is adapted to load and assemble a body component to a vehicle body. The all-in-one jigless projection loading system may include: a fixing bracket fixed to an arm of a robot; a position adjusting member rotatably mounted to the fixing bracket; a gripper mounted to the fixing bracket to be movable backward and forward, and gripping the body component; an array unit mounted to the position adjusting member, and arraying the body component; and a welding unit mounted to the fixing bracket, and projection-welding the body component to a vehicle body.
US09895758B2	Ring tool unit, method for manufacturing the same, sleeve, and mandrel An object is to prolong the life of a ring tool, and improve the productivity of a welded pipe. A ring tool unit is held in a downstream-side end portion of a mandrel to be inserted into a welded pipe currently being manufactured from the upstream side of a welding position, and is used as a cutting tool for continuously cutting a bead produced on the inner surface of the welded pipe, wherein the ring tool unit is formed by fitting a ring tool having a ring-like blade in a sleeve having a circular hole for holding the outer circumference of the ring tool.

1 2 3 4 5 6 7 8 9 10